KEGG   Bacillus vallismortis: B9C48_03740Help
Entry
B9C48_03740       CDS       T04948                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00627  Aminobenzoate degradation
bvm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B9C48_03740
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     B9C48_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARM26983
UniProt: A0A1W6HFN8
LinkDB All DBs
Position
719030..720487
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFQKATSDDVDAAYRAAALAKQE
WDKVNPFKKRAILENAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVVKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatggaagc
agccggaacgtattggaaaacagaaatccttatactcaaaaagtcatcacctcattccaa
aaagcgacgtctgatgatgtggatgcggcatatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaacgccgtttctttcatt
gaagagcacgaagaagcgattatttacttaatcatggaggagcttggcggaacacggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgacggaaaagaaaacagactgtac
agaatacccgccggagtcgtgggggtgatcagcccgtttaatttcccgtttttcctttcg
atgaaatctgttgcgccggcactcggcgcggggaacggcgtcgtgctgaagcctcatgaa
gaaacaccgatctgcggcggaacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctcaatgttatcgtgacagatatcggggagatcggcgacagctttgttgag
catcccgtgccgcggattatctcatttacaggctcaaccggagtgggcagctatatcgga
cagcttgcagtcaaacactttaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggatgctgatcttgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcaaggccagatctgtatgtcggcgaaccgcgtgctcgttcacacatctgtatat
gacaaatttacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcggtcctttaatcaatgagaggcaggcggaaggtctgagacgg
tctgtcgtaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcccgtcattttaaaagatgtgaaacctgagatgagcatcgcgaaggag
gagctgttcggaccggccgtctgcatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgttgagcgc
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgaccatt
aatgatgaaccgaacgtcgcgttcggcggcgagaaacaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cggcaattcccatattaa

DBGET integrated database retrieval system