KEGG   Bacillus vallismortis: B9C48_04635Help
Entry
B9C48_04635       CDS       T04948                                 

Definition
(GenBank) transporter
Organism
bvm  Bacillus vallismortis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD HlyD_2 QRPTase_N Peptidase_M23 DUF3221
Motif
Other DBs
NCBI-ProteinID: ARM27133
UniProt: A0A1W6HG15
LinkDB All DBs
Position
893055..893687
Genome map
AA seq 210 aa AA seqDB search
MNRGRLILTNIIGLIVVLAIIGGGAYYYYQSTHYVKTDEAKVAGDMAAITAPAAGKVTDW
NLDEGKEVSKNDVVAKIKGQQNADVKAIMDGTIVKNEVKNGQMVQAGTTIAQEIDMKHLY
ITANIKETDIRDIEVGNKVDVIVDGDPNTTFDGTVEEIGYATNSTFDMLPSSNSSGNYTK
VTQKVPVKISLSNPSDKVLPGMNASVKISE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaggacgtttaattctgaccaacattatcggtttgattgttgttcttgcaatt
ataggcggaggtgcttactactattatcaaagcacacactatgtaaaaaccgatgaagca
aaagttgccggcgacatggctgctatcacagctcctgctgcgggtaaagtaactgactgg
aaccttgatgaggggaaagaagtaagcaaaaacgacgttgttgcaaaaatcaaaggacag
caaaatgctgacgtaaaagccatcatggatggaacaatcgtgaaaaacgaagtgaaaaac
ggccaaatggtgcaagccggtacgacaattgcccaagaaattgacatgaaacacctttac
atcactgcaaacattaaagaaacagacattagagacattgaagtaggaaacaaagtagac
gtaattgttgacggcgaccctaatacaacatttgacggaacagtagaagaaatcggttat
gcgacaaattcaacatttgatatgctgccttcttcaaactcaagcggcaactacacaaaa
gtaacgcaaaaagttcctgttaaaatttcactcagcaacccatctgacaaggtgcttcct
ggtatgaacgcatctgtaaaaatctctgaataa

DBGET integrated database retrieval system