KEGG   Bacillus vallismortis: B9C48_04760Help
Entry
B9C48_04760       CDS       T04948                                 

Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00561  Glycerolipid metabolism
bvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    B9C48_04760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvm04147]
    B9C48_04760
Enzymes [BR:bvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     B9C48_04760
Exosome [BR:bvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B9C48_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ARM27154
UniProt: A0A1W6HGC7
LinkDB All DBs
Position
915336..916826
Genome map
AA seq 496 aa AA seqDB search
METYILSIDQGTTSSRAILFNKEGKIVHSAQKEFTQHFPQPGWVEHNANEIWGSVLAVIA
TVISESGISADQIAGIGITNQRETTVVWDKDTGKPVYNAIVWQSRQTSSICEELREKGYN
DTFREKTGLLIDPYFSGTKVKWILDNVEGAREKAENGNLLFGTIDSWLIWKMSGGAAHVT
DYSNASRTLMFNIHELKWDDELLDILGVPKSMLPEVKPSSHVYAKTVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAITSDHGLLTTIAWGLDGKVEYA
LEGSIFVAGSAIQWLRDGMRMFQDSKESETYAERVDSADGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQAKDVLDAMEADSGISLKTLRVDGGAVKNNFLMQF
QSDLLDVPVERPEINETTALGAAYLAGIAVGYWKDSTEIADQWNLDKQFKPEMEDEKRDE
LYGGWKKAVNAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagacctatattttatcaattgaccaaggcacaacaagttcaagagcgattcttttt
aataaagaaggaaaaatcgtgcattccgctcaaaaggaattcacacagcatttccctcag
ccgggctgggtggagcacaatgcgaacgaaatctggggatcggtgctcgccgttatcgcg
actgtgatctccgagtccggaatcagcgctgatcaaattgccggcatcggcatcacgaac
caaagggaaacgacggtcgtatgggataaagataccggaaagccggtatacaatgcaatt
gtgtggcaatcgagacaaacatccagcatttgcgaagagcttcgtgaaaaaggatataat
gatacattcagagaaaaaacgggacttttgatcgacccttatttctcaggaacgaaagtc
aaatggattcttgacaatgtagaaggcgcgcgggaaaaagcggaaaacggaaatcttctg
ttcggaacgattgattcatggctcatctggaaaatgtccggaggggcggcgcacgtaacg
gattattccaacgcttcaagaacgctgatgtttaatatacatgaattaaaatgggatgac
gagctgcttgatattttaggcgtaccgaaatcaatgctgccggaagtgaaaccgtcttct
catgtgtacgcgaaaacggttgattatcatttctttggtaaaaatattccgattgcggga
gcggccggagaccagcagtctgcgctgttcggtcaggcgtgctttgaagaaggcatgggg
aaaaacacatacggcacaggctgctttatgctgatgaataccggagaaaaagccatcact
tctgatcacggccttctgacgacaatcgcctggggattagacggaaaagtcgagtatgca
ttggaaggaagcatctttgtcgcaggttctgccatccaatggctgagagacggcatgcgg
atgttccaggattcgaaagaaagcgagacatacgcagagcgtgtggattccgctgacggt
gtttatgtcgtgcccgctttcgtcggattgggcacaccgtactgggacagtgacgtgcgc
ggctcagttttcggcctgacacgcggaacgacgaaggagcattttatccgtgccacgctt
gaatctctcgcatatcaggcgaaagatgtgcttgatgccatggaggctgattcaggcatc
tctttaaaaacattgcgtgtagacggcggagcggtaaaaaataacttcctcatgcagttc
cagagcgacttgcttgatgtgccggtcgaacgtccggaaattaatgaaacgacggcgctc
ggtgccgcgtatttagccggaatcgctgtcggctactggaaggacagcactgaaatcgcc
gatcagtggaaccttgataagcaattcaaaccggaaatggaagatgaaaaacgcgatgaa
ttgtacggcggatggaaaaaagcagtaaatgcagctatggcttttaaataa

DBGET integrated database retrieval system