KEGG   Bacillus vallismortis: B9C48_09520Help
Entry
B9C48_09520       CDS       T04948                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00330  Arginine and proline metabolism
bvm01100  Metabolic pathways
bvm01110  Biosynthesis of secondary metabolites
bvm01130  Biosynthesis of antibiotics
bvm01230  Biosynthesis of amino acids
Module
bvm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    B9C48_09520
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     B9C48_09520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH ApbA Sacchrp_dh_NADP TrbI
Motif
Other DBs
NCBI-ProteinID: ARM28052
UniProt: A0A1W6HIN8
LinkDB All DBs
Position
complement(2006892..2007740)
Genome map
AA seq 282 aa AA seqDB search
MLPILDQKKVAFIGAGSMAEGMISGMVRAKKIPNQNICVTNRRNTERLAELEHQYGIQGI
AFDSMKTEDIDVFILAMKPKDAEIALATLKRRIQPHQIILSVLAGITTSFIQQSLHDRQP
VVRVMPNTSSMIGESATAAAFGDHVSYGSAKTAVSLLECLGEVYVIKEDQMDIFTGIAGS
GPAYFYYLMEFIEKAGEEAGLDKRLSRKIGAQTLLGAAKMLMETGEKPDVLRENITSPNG
TTEAGLDALRSEGGGEAIAKAIKHATERSIEISKTIEKTAAL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgatcttagatcaaaagaaagttgcttttatcggagcaggatcaatggctgaa
ggaatgatatcaggcatggtccgcgcaaaaaaaattcccaaccaaaacatctgcgtgaca
aaccgccgcaatacagagcgactcgctgaattggaacatcagtacggaattcagggcatt
gcttttgacagcatgaaaaccgaagatattgatgtctttattttagccatgaagccgaag
gatgccgaaatcgctctggctacgctgaaacggcgtattcaacctcatcaaattatcctg
tctgttctggcaggcataacaacctcatttatacaacaatcattacatgatcgtcagcct
gttgtaagagtgatgccgaacacatccagcatgatcggcgaatcggcaacagctgcggct
ttcggagaccatgtctcttacggttcagcaaaaaccgcggtatcccttttggaatgcctc
ggggaagtgtacgtgatcaaggaagatcagatggacattttcaccggcattgcaggcagc
ggaccggcgtacttttattatttaatggagtttattgaaaaagcaggtgaagaagccggc
ttagacaaacggctgtcccgcaaaatcggcgcgcaaacgttattgggcgcagctaaaatg
ctgatggaaacgggtgaaaaaccggatgtgcttcgggaaaacatcacctctccaaacggc
acgacggaagccggcctcgatgcgctcaggtcagaaggcggcggagaagccattgccaaa
gccattaaacacgcgaccgaacgttctattgagatcagcaaaacaattgaaaaaacggca
gcactataa

DBGET integrated database retrieval system