KEGG   Bacillus vallismortis: B9C48_09745Help
Entry
B9C48_09745       CDS       T04948                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00020  Citrate cycle (TCA cycle)
bvm00310  Lysine degradation
bvm00380  Tryptophan metabolism
bvm01100  Metabolic pathways
bvm01110  Biosynthesis of secondary metabolites
bvm01120  Microbial metabolism in diverse environments
bvm01130  Biosynthesis of antibiotics
bvm01200  Carbon metabolism
Module
bvm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B9C48_09745
  09105 Amino acid metabolism
   00310 Lysine degradation
    B9C48_09745
   00380 Tryptophan metabolism
    B9C48_09745
Enzymes [BR:bvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B9C48_09745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ARM28094
UniProt: A0A1W6HIY6
LinkDB All DBs
Position
complement(2044830..2046077)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPANEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQPKQQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNDVK
LGFMSFFTKAVVAALKKFPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEREIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaactggagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacccgccccttcagaaagtgctccagccaatgaacaaacgaaagaggaa
gcaaaagctgaacctgctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctatca
caaattccgacgggagacccgctcggccgcgtgcgcaaacaagatgtagaagcttatgaa
aaaccggcttcaaaacctgcggcacagccgaaacagcaggctcaaaaaacacagcaaagc
tttgacaaacctgtcgaagtgcaaaaaatgtcccgccgcagacaaacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgactacatttaacgaagttgacatgacg
gccgttatgaatctaagaaaacgccgtaaagaccaattccttgagcaaaacgatgtaaaa
ctcggtttcatgtcgttctttacaaaagccgtcgtggctgcattgaaaaaattcccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gctgtcgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgaccgcctgacg
tttgccggcattgaaagagagatcggcgaacttgcgaaaaaagcgcgaaataataaatta
acattaggtgagctgcaaggaggctccttcacgattacaaacggaggtacattcggatcg
cttatgtcaacaccgatcctaaacagccctcaggttgggatcttaggtatgcacaaaatt
cagctgcgcccagtagcgattgatgcggagcgctctgaaaaccgtccgatgatgtacatc
gctttatcatacgaccacagaattgtagatggtaaagaagcggtcggattccttgtcacc
attaaaaacctgcttgaagatccggaacagctgttgctggaaggataa

DBGET integrated database retrieval system