KEGG   Bacillus vallismortis: B9C48_13380Help
Entry
B9C48_13380       CDS       T04948                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00020  Citrate cycle (TCA cycle)
bvm00480  Glutathione metabolism
bvm01100  Metabolic pathways
bvm01110  Biosynthesis of secondary metabolites
bvm01120  Microbial metabolism in diverse environments
bvm01130  Biosynthesis of antibiotics
bvm01200  Carbon metabolism
bvm01210  2-Oxocarboxylic acid metabolism
bvm01230  Biosynthesis of amino acids
Module
bvm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B9C48_13380
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B9C48_13380
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B9C48_13380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ARM28780
UniProt: A0A1W6HLA3
LinkDB All DBs
Position
complement(2760985..2762256)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTNMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSDAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
attatcccgtttattgaaggcgacggcacaggccctgatatttggaacgccgcttctaaa
gtattggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgagtggcttcctgccgaaacgctg
gaagacatcagagagtacttcatcgccatcaaaggtcctctgacgacaccggtcggcggc
ggtatccgttctctgaacgtggcgctgagacaggagcttgatttgtttacgtgcctgcgc
cctgtcagatatttcacgggagtgccttctccggttaaacgtcctgaagatacgaatatg
gtcattttccgcgagaatacggaagatatttacgccggaattgagtatgcgaaaggttct
gaagaagttgaaaagctgatcagcttcctgcaaaatgaaatgggtgttaacaaaatccgt
ttccctgaaacgtcaggaatcggcatcaaacctgtttctgaagaaggcacaagccgctta
gtcagagctgccattgagtatgcgatcgaaaacggccgtaagtctgtcacgcttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgcc
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacggaaaagaagcggctgataaagcgcagagcgacgcggaagcggcaggaaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgtccgagcgaattc
gacgtcgtggcgacaatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaagtatgccggccttgacaaagtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggtgcaactgaagtgaaatgttcagagtttggtgaagagctaatcaaa
aacatggactga

DBGET integrated database retrieval system