KEGG   Bacillus vallismortis: B9C48_15325Help
Entry
B9C48_15325       CDS       T04948                                 

Definition
(GenBank) MFS transporter
Organism
bvm  Bacillus vallismortis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr MFS_3 OATP MFS_2 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ARM29116
UniProt: A0A1W6HME3
LinkDB All DBs
Position
3117897..3119492
Genome map
AA seq 531 aa AA seqDB search
MSIEKKDPKRTLLITGLIIAMFFSALDGTIVGTAIPKIVGDLGGLSMMTWLTTAYLLTST
TIVPIAGKLADLLGRRVVYVSGLLIFMGASALCGMASNMTELIIFRGLQGIGGGVMMPMA
MIVIGDLFTGKQRAKFQGLFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGILAVI
FIARGLQGRKQTGPINFDIAGIFTMIVGIVSLLLALSFGGKDYAWGSWQILGLFALALAG
IVGFIFAEIKAKEPILPMYLFKNRTFTVLNLIGFFMSIGMFGAVTFVPFFMQGIIGVSAT
ASGTIMTPMMVSMIITSIIGGQLVYKIGIKPQIMIGMLIMAVGFFLLTTLQLDTSKLAAT
CYMAVIGLGMGLVMPLLTLALQETFSKEELGVVTSSSQFFRMIGGTFGITVLGAVMNARS
GSLLTDRLVPYLDSLPKQASAFAAQFKGMIDKNPEGLLQSLFSQESIKQIPAAFSSHIVP
VLKTSLMDSLHSVFFTGLAFIAAGLILTLFVKSIKLTNKKTGKQEEKAKAV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaaaagaaagatccaaaacgcacattattaataaccggcttaatcatcgcc
atgtttttctcagcccttgacggcaccatcgtaggaacggcgattcctaaaatcgtgggt
gacctcgggggattaagcatgatgacgtggctgaccacagcatatcttttaacttcgacg
acgatcgttccgattgcggggaaacttgcagatttattggggcgccgcgtcgtctatgta
tcaggtttattgatttttatgggagcttccgcactgtgcggaatggccagcaacatgacg
gaactgattattttccgcggacttcagggaatcggcggcggtgtcatgatgccgatggct
atgatcgtcatcggggatttgttcacagggaaacagcgtgccaagttccaagggcttttc
ggggcgatttacgggcttgcttccgtgatcggcccgcaaatcgggggatggattgttgac
tcattaaattggaaatgggttttctatatcaacctgcctgtcggaattttagccgtcatc
tttatcgcaagaggacttcaaggcagaaaacagaccgggccgattaactttgacatcgcc
ggcattttcacaatgatcgtcggaatcgtcagcctcctcctcgcgctcagcttcggagga
aaggattacgcatggggctcttggcagattctcggtctctttgcgcttgcacttgccggg
attgtcggattcattttcgctgaaatcaaagcaaaagaaccgattctgccgatgtacctg
tttaaaaacagaacgtttaccgtactgaatctgatcggctttttcatgagtatcggcatg
ttcggcgccgtcacgtttgttcctttctttatgcagggaattatcggagtcagcgccacc
gcgtccggcacgattatgacgccgatgatggtatctatgattatcacaagtattatcgga
ggccagctggtttataagatcggtattaaaccgcaaatcatgatcggcatgctgatcatg
gccgtcggcttcttcttattaacgactttgcagctggatacaagcaagctcgcggctaca
tgctatatggccgtgatcggtctgggaatggggctcgtcatgccgcttctcacactcgct
ctgcaagaaacgttttcaaaagaagagctgggtgttgtgacctcttcaagccaatttttc
cggatgatcgggggaacgttcggcattacggtgctcggcgctgtcatgaatgccagatca
ggaagccttttaaccgacagactggtgccttacttagactcactgccgaaacaggcaagt
gcctttgccgcccagtttaaaggtatgattgacaagaatcctgaagggctgcttcaatcc
ttgttcagccaggaatcgattaagcagattccggccgcattttcttcccatatcgtgccg
gttttgaaaacgtcactgatggattcgcttcacagcgtgtttttcacaggcctggccttt
atcgctgccggattgatcctcacgctgtttgttaaatcaattaaactgacaaacaaaaag
acaggcaaacaagaagaaaaggcgaaagccgtttaa

DBGET integrated database retrieval system