KEGG   Bremerella volcania: Pan97_07860
Entry
Pan97_07860       CDS       T06456                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
bvo  Bremerella volcania
Pathway
bvo00620  Pyruvate metabolism
bvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pan97_07860
Enzymes [BR:bvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     Pan97_07860
SSDB
Other DBs
NCBI-ProteinID: QDU73786
UniProt: A0A518C3I7
LinkDB
Position
943910..947374
AA seq 1154 aa
MDLRESLGIRQPGEVFDPKSDRQELIRYINLQLIANELPPALDASDVEFAGLAKGLLANY
HEKTRMLYDRPAPIDQRIEAFLARYFGDLNPSQPLQLPRKSFTLERHGVARELSIPVNRS
SFKSELVESYRIANGALHNPRHDRRTTKGTFHVTEGGLPIAGDKRVVPREVFMKMFQIAV
NPPESDTLLPFTADQENAAHSIVSLLLRPIVCPEVPGVTPEKTMEVRFFAPGQLVSNLDF
VESIFGNAGDPYISKNNSALDVEHWTGHTGCVILAPHLGTHTKKELGLPHWDDATERQRN
DSMCWKEDSELYNDGMAFKLTCRDASGVVVTLIADNYYGYCKKEVKTQISYAANLYGDTE
EEHAGGCIAYTSWNLGDEFKVNSQKYNGRTIDDVMQDYGDLIDFQPEGYGIDKKHPEVFY
IPEDARATMLDQCIKWTRDGKQHSLPLLPNRYYIAPSGYKIRMEKHPAAPSWRLVGSTAE
GIFCHKPCTVSGGGKSEISKSLTDYTLYGPIFVSDIEKDLDQVEEIFQKDYSKRWKADST
KRPDYSARPSRAVLSADRTLGSVIKLLTPSIEYTDEYNEWLQAIPHHITSMVFIIKRLML
PEWGENWRDYFGVDIVNGVPGHELKVLDRHLVGTYLRVGFNKDNRWRTYKLRQDFMPSDK
VQTEDDISASVIVPNAMLENFEPQPGGISSKFTINCENRLFQRPDDAIHRGFDKKTEIDL
AKPNNFISNFEPLTKEYVDQMATHAVDFDAFTQPMKSFLNSFLDSEYEYVVSSANPRLVN
GVPTKNPRYLQTRPDLENPLPKYVGEMGVRLYRKLKPDQPLYQPVGAVLCGRRNNPPDKE
AGIRGLAVYGPIHYQELPELFMDFIASLTGKSPSTTGAGSEGALTKGPFNCLRPTADLNQ
ALVGYILTGLGGFSTAAGHIGPNVRVDHDVSLLIPEVWCRLTPEERDPEFLIRQRMLEKV
EDFEYEGETIPGSRLGYRITRGFVRMFFGRVFDYPLSVFDESILKPETQDMEAYVDGIKH
IAEVQQRVAKRYFDDGSIEEACPPLKALLAIMAEGNYEGMTVHDPEFRTLFTRDSLLASD
WYKERLTTKQQRDIQLWQRHMKSLEDFLKNSVYLEDDMQEELERRKQYVQRQLAKLQAPE
YLQSQIGAIGVQPM
NT seq 3465 nt   +upstreamnt  +downstreamnt
atggacttacgagaatcccttggcattcgccaacccggtgaagtcttcgatccgaaatcg
gatcggcaagaattgattcgctacatcaacttgcaactgattgccaacgaactgcctccg
gcgctcgatgcgagcgatgtggaattcgccggcctggccaagggattgcttgccaactat
cacgaaaaaacgcggatgctgtacgatcgtccggctccgatcgatcagcggatcgaagcg
ttcctggcccgctactttggcgacttgaatcccagccagccgttgcaactgccgcgcaag
agcttcacgcttgagcgtcacggcgttgcccgcgagctttcgattcccgtcaatcgttct
tccttcaagagcgaactggtcgaatcgtatcgcattgccaacggagcgctgcacaatccg
cggcacgatcgccgtaccaccaaggggaccttccacgtcaccgaaggaggcttaccgatc
gccggcgacaagcgtgtcgtgccgcgggaagtcttcatgaagatgttccagatcgcggtc
aatccgcctgagtcggacacgctgctgccgtttaccgccgatcaagagaacgcggcccac
agcattgtttcgcttctcttgcggccgattgtctgtccggaagttcccggggtgacgcca
gagaagaccatggaagtccgcttcttcgcgccggggcagttggtcagcaacctggacttc
gtcgaatcgattttcggcaacgccggcgacccctacatctcgaagaacaactcggcgctg
gatgtcgagcattggaccggccacaccggctgcgtgatcctggctccgcatttgggaacg
cataccaagaaggaactgggccttccgcattgggacgatgccaccgagcgtcagcgcaac
gactcgatgtgctggaaggaggactccgaactgtacaacgacggcatggccttcaagctg
acctgccgcgatgccagcggcgtggtggtgactttgatcgccgacaactactacggctac
tgcaagaaggaagtcaaaacgcagatcagctatgccgcgaacctgtacggcgatacggaa
gaagagcacgccggcggctgcattgcctacaccagctggaacctgggtgacgagtttaag
gtcaacagccagaagtacaacggccgcacgatcgacgacgtcatgcaagactatggcgat
ttgattgatttccagccggaaggttacggcatcgataagaaacaccccgaggtgttctac
attccggaagatgcccgggccacgatgctcgatcagtgcatcaagtggactcgcgacggc
aagcagcacagcctgccactgctccccaaccggtactacattgcgccatccggttacaaa
atcaggatggaaaagcacccggctgctccgagttggcgcttggtgggttcgaccgccgaa
gggatcttctgccacaagccgtgtaccgtgagcggtggcggtaagagcgaaatcagcaag
tcgctgaccgactatacgttgtacggtccgattttcgtttccgatatcgagaaggacctt
gaccaggtcgaagagatcttccagaaagattactcgaaacgctggaaggcggattcgacg
aagcggcctgactattcggccaggccatcgcgagccgttttgtcggccgatcgaacgctg
ggcagcgtgatcaaactgctgaccccttcgattgaatataccgacgagtacaacgaatgg
ctgcaggccattccgcatcacatcacgtcgatggtcttcatcatcaagcgattgatgctg
cctgagtggggcgagaactggcgggattacttcggcgtcgacatcgtgaatggggtgccc
ggtcacgagttgaaagtgctcgatcggcacctggtaggtacctacctgcgagttggcttc
aacaaagacaatcgctggcgaacctacaagctgcggcaagacttcatgccgtcggataag
gtgcagaccgaggacgacatcagcgcttcggtgatcgttcccaatgccatgttggaaaat
ttcgaaccgcagccggggggcatttcctcgaagtttaccatcaactgcgagaatcgtttg
ttccagcgacccgatgatgcgatccatcgcggtttcgataaaaagacggaaatcgacctg
gccaagcccaacaattttatctcgaacttcgagccgctcaccaaagagtacgtcgatcag
atggcgacccatgcggtcgacttcgacgcgttcacgcagccaatgaagagctttttgaac
agctttcttgattcggaatacgagtatgtggtcagttccgcgaatccgcgcctggtcaac
ggcgtaccgaccaagaatccgcggtacctgcaaacgcggccagatctcgaaaacccgctg
cccaaatacgtcggcgagatgggtgttcggttgtatcgcaagctgaagccagaccaaccg
ctgtatcagccggtgggggcggtcttgtgcggacgccgcaacaatccgccagacaaggaa
gcaggcatccgcggtctggccgtttacggtccgatccactaccaggaactgccggagctg
ttcatggacttcatcgcgtcgctgaccggtaagagcccttcgaccactggtgccggtagt
gaaggggccctcaccaaggggccgttcaactgcctgcgtccgacggccgatttgaaccag
gcattggtaggttacatcctcaccgggctgggcggcttctcgacggcggcggggcacatc
ggtccgaatgtacgtgtcgatcacgacgtcagtctgctcattccagaagtctggtgccgc
ctgacgccggaagaacgcgatcccgagtttctgattcgtcagcgaatgctcgagaaggtc
gaagactttgaatacgaaggggaaaccattcctggcagccgcctgggctaccgcattact
cgcggcttcgtacggatgttcttcggtcgcgtgttcgactatccgctgtcggtctttgac
gagtcgatcttgaagccggaaacgcaagacatggaggcgtacgtcgacggcatcaagcac
atcgccgaggtacaacagcgagtcgccaagcgctacttcgacgatggctcgatcgaagaa
gcctgcccacccttgaaggccctgctggccatcatggccgaaggaaactacgaaggcatg
acggttcacgatcctgagttccggacactgttcacccgcgactcgctgctggcaagcgac
tggtacaaagaacgcctgaccaccaagcagcagcgcgacatccagctgtggcagcgtcac
atgaagtcgctggaagacttcctgaagaactcggtctacctggaagacgacatgcaggag
gaactcgagcgacgtaagcagtacgtccagcggcagctggcgaaactgcaggctcccgag
tacctgcaaagccagatcggagcgatcggcgtccagccgatgtaa

DBGET integrated database retrieval system