KEGG   Blastochloris viridis: BVIR_1372Help
Entry
BVIR_1372         CDS       T04109                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bvr  Blastochloris viridis
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bvr03012]
    BVIR_1372
   03029 Mitochondrial biogenesis [BR:bvr03029]
    BVIR_1372
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvr04147]
    BVIR_1372
Translation factors [BR:bvr03012]
 Eukaryotic Type
  Elongation factors
   BVIR_1372
 Prokaryotic Type
   BVIR_1372
Mitochondrial biogenesis [BR:bvr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BVIR_1372
Exosome [BR:bvr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BVIR_1372
  Exosomal proteins of breast cancer cells
   BVIR_1372
  Exosomal proteins of colorectal cancer cells
   BVIR_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ALK09157
UniProt: A0A0H5BK68
LinkDB All DBs
Position
1506096..1507286
Genome map
AA seq 396 aa AA seqDB search
MAKEKFQRNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGASFTAYDQIDKAPEEKARG
ITISTAHVEYQTAKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLDLVELEVRELLSKYDFPGDDIPIVKGSALMALE
DKSPEIGHEAILKLMEAVDAYIPQPERPKDQPFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEVEIVGIRPTTKTTVTGVEMFRKLLDQGEAGDNVGCLLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVS
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaaatttcagcggaataagccgcactgcaatatcggcaccatcggtcac
gtcgaccatggcaagacctctctgaccgctgcgatcacgaaggtgctcgccgagacgggt
ggcgcgagctttactgcctacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgaccgctcacgtcgagtatcagaccgccaagcgccactacgcgcacgtc
gactgccccgggcacgccgactatgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgctatcttggtggtctccgccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgtcaggtcggcgtgccggcgctggtggtgttcatgaacaaggtcgacatg
gtcgacgaccccgagctgctcgacctcgtcgagctcgaggttcgcgaacttttgtcgaag
tacgacttccccggcgacgacattccgatcgtcaagggctcggcgctgatggcgcttgaa
gacaagagcccggagatcggccatgaggcgatcctgaagctgatggaggcggtcgacgcc
tacattccgcagccggagcgtcccaaggatcagccgttcctgatgccggtggaagacgtg
ttctcgatctccggccgcggcaccgtggtgaccggtcgtatcgagcgcggcgttgtcaag
gtgggcgaggaagtcgagatcgtcggcatccgtccgaccaccaagacgacggttaccggc
gtcgagatgttccgcaagctgctcgatcagggcgaggctggcgacaacgtcggttgcctg
ctgcgtggcaccaagcgcgaggacgtcgagcgcggccaggtgctgtgcaagccgggctcc
gtgaagccgcacaccaagttcaaggctgaggcgtacatcctcaccaaggaggaaggcggt
cgtcacacgccgttcttcacgaactatcgtccgcagttctatttccgtacgaccgacgtg
accggtgtcgtccatctgccggaaggcactgagatggtgatgcctggcgacaacgtctcg
atggaagtccacctgatcgtgccgatcgcgatggaagagaagctccgcttcgccattcgc
gaaggtggccgcacggttggcgccggcgtcgttgccagcatcatcgagtaa

DBGET integrated database retrieval system