KEGG   Blastochloris viridis: BVIR_2654Help
Entry
BVIR_2654         CDS       T04109                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bvr  Blastochloris viridis
Pathway
bvr00020  Citrate cycle (TCA cycle)
bvr00190  Oxidative phosphorylation
bvr00650  Butanoate metabolism
bvr01100  Metabolic pathways
bvr01110  Biosynthesis of secondary metabolites
bvr01120  Microbial metabolism in diverse environments
bvr01130  Biosynthesis of antibiotics
bvr01200  Carbon metabolism
Module
bvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bvr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVIR_2654
   00650 Butanoate metabolism
    BVIR_2654
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVIR_2654
Enzymes [BR:bvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVIR_2654
    1.3.5.4  fumarate reductase (quinol)
     BVIR_2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2
Motif
Other DBs
NCBI-ProteinID: ALK10419
UniProt: A0A0P0ITD3
LinkDB All DBs
Position
complement(2940436..2941215)
Genome map
AA seq 259 aa AA seqDB search
MVQFTLPKNSKVKQGKVWPHPKGAVNLTELRIYRWDPEDGHNPRIDTYYVDRGDCGPMVL
DGLIWIKNKVDPTLTFRRSCREGICGSCAMNIDGVNTLACTKGMDEVKGVIKIYPLPHMP
VVKDLVPDLTAIYAQHAAIDPWLKTVTPAPEKEWEQTHDDRAKLDGLYECILCFCCSTSC
PSYWWNADRYLGPAVLLQAYRWIIDSRDEYTGERLDHVEDPFRLYRCHTILNCSKACPKG
LNPAKAIAEIKKLLVERQT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtccagttcacgctgccgaagaactccaaggtcaagcagggcaaggtgtggccgcac
cccaagggtgcggtcaacctcaccgagctgcgcatctaccgctgggatcccgaggacggc
cacaatccgcgcatcgacacctattacgtcgaccgcggcgattgcgggccgatggtgctc
gacgggctgatctggatcaagaacaaggtcgacccgaccctgaccttccgtcgctcatgc
cgcgagggcatctgcggctcgtgcgcgatgaatatcgacggcgtcaacaccctggcctgc
accaagggcatggacgaggtgaagggcgtcatcaagatctatccgctgccgcacatgccg
gtggtgaaggatctggtgcccgacctcaccgcgatctacgcccagcacgccgccatcgat
ccgtggctgaagacggtgacgccggcgccggaaaaggagtgggagcagacccacgacgac
cgcgccaagctcgacgggctctacgagtgcatcctgtgcttttgctgctcgacctcgtgc
ccgagctactggtggaacgccgaccgctatctcggcccggcggtgctgctgcaggcctat
cgctggatcatcgacagccgcgatgaatacaccggcgagcggctcgaccacgtcgaggac
ccgttccggctctatcgctgccacaccatcctcaactgctcgaaggcatgcccgaagggc
ttgaacccggcgaaagcgatcgccgagatcaagaagctcctggtcgaacggcagacctga

DBGET integrated database retrieval system