KEGG   Blastochloris viridis: BVIR_2656Help
Entry
BVIR_2656         CDS       T04109                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bvr  Blastochloris viridis
Pathway
bvr00020  Citrate cycle (TCA cycle)
bvr00190  Oxidative phosphorylation
bvr00650  Butanoate metabolism
bvr01100  Metabolic pathways
bvr01110  Biosynthesis of secondary metabolites
bvr01120  Microbial metabolism in diverse environments
bvr01130  Biosynthesis of antibiotics
bvr01200  Carbon metabolism
Module
bvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bvr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVIR_2656
   00650 Butanoate metabolism
    BVIR_2656
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVIR_2656
Enzymes [BR:bvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVIR_2656
    1.3.5.4  fumarate reductase (quinol)
     BVIR_2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ALK10421
UniProt: A0A0H5BPP3
LinkDB All DBs
Position
complement(2941592..2943421)
Genome map
AA seq 609 aa AA seqDB search
MATNGSNGATAPSINGKAYPITEHKYDVVVVGAGGAGLRAVVGCSQAGLRTACITKVFPT
RSHTVAAQGGVAASLGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMVRNAPAAVYELEHW
GVPFSRTEDGKIYQRPFGGMTTHFGKGIAQRTCAAADRTGHAMLHTMYGAALKHRAEFFV
EYFALDLIMEGGACRGVIALKLDDGTLHAFRSHKTVLATGGYGRAYFSATSAHTCTGDGN
AMVLRAGLALQDMEFVQFHPTGIYGSGCLITEGSRGEGGYLVNAAGERFMERYAPSAKDL
ASRDVVSRSMTIEIREGRGVGKNKDHIYLHLDHLDPKVLAERLPGISESAMIFAGVDVTK
EPIPVIPTVHYNMGGIPTNFHGEVLTKAGGNPDQVVPGLLAVGEAACVSVHGANRLGSNS
LIDLVVFGRAAGARCAETIDKRGHDDLPGDAYDAALGRLDTLRHASGSTPTAKLRLEMQK
VMQSNCAVFRTGEVLAEGKELIHQVWQTSADLKVTDRSLIWNSDLIETLEFDNLIAQAVV
TMEAAANRTESRGAHAREDFPDRDDANWMKHTLLWADPVKKSVTIDYRPVHTYTLSNDVE
YIEPKKRVY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaacggctccaacggcgcgacggcgccttcgatcaacggcaaggcctatccg
atcaccgagcataagtacgacgtggtggtggttggcgccggcggcgcgggccttcgcgcc
gtggtcggctgctcgcaggccgggctgcgcacggcgtgcatcaccaaggtgttccccacc
cgctcgcacaccgtggcggcgcagggcggcgttgccgcctcgctcggcaacatgggcgag
gacgattggcgctggcacatgtacgacaccgtcaaggggtcggactggctcggcgaccag
gacgccatcgaatacatggtgcgcaacgcccccgccgcggtctacgagctggagcactgg
ggcgtgccgttctcgcgcaccgaggacggcaagatctaccagcgcccgttcggcggcatg
accacgcatttcggcaagggcatcgcgcagcgcacctgcgccgccgccgaccgcaccggc
catgccatgctgcacaccatgtacggcgcggcgctgaagcaccgcgccgagttcttcgtc
gagtatttcgcgctcgacctgatcatggagggcggcgcctgccgcggcgtgatcgcgctg
aagctcgacgacggcacgctgcacgcgttccgctcgcacaagaccgtgctcgccaccggc
ggctacggccgcgcctacttttcggcgaccagcgcccacacctgcaccggcgacggcaac
gccatggtgctgcgcgccggcctcgccctgcaggacatggagttcgtgcaattccacccg
accggcatttacggttcgggctgcctgatcaccgagggctcgcgtggcgagggcggctat
ctcgtcaacgccgccggcgagcgcttcatggagcgctacgcgccgtccgccaaggatctc
gcctcgcgcgacgtggtgtcgcgctcgatgacgatcgagatcagggaaggccgcggcgtc
ggcaagaacaaggaccacatctacctgcacctcgaccatctcgatcccaaggtgctggcc
gagcgcctgcccggtatctccgagagcgcgatgattttcgccggcgtcgacgtcaccaag
gagccgatcccggtcatcccgaccgttcactacaacatgggtggcatcccgaccaatttc
cacggcgaggtgctgaccaaggcgggcggcaatcccgaccaggtggtgccgggtctgctc
gcggtcggcgaggcggcgtgcgtgtcggtgcacggcgccaaccgcctcggctcgaactcg
ctgatcgacctcgtggtgttcggccgcgccgccggcgcgcgctgcgccgagaccatcgac
aagcgtggtcacgacgacctgcccggcgacgcctacgacgccgcgctgggccggctcgac
accctgcgccacgcctcgggctcgaccccgaccgccaagctgcgccttgagatgcagaag
gtgatgcagtcgaactgcgcggtgttccgcaccggcgaggtgctggcggaaggcaaggaa
ctgatccaccaggtgtggcagacctcggccgatctcaaggtcaccgaccgctcgctgatc
tggaactccgacctgatcgagacgctggagttcgacaatctgatcgcgcaggcggtggtg
acgatggaggcggccgcgaaccgcaccgagtcgcgcggcgcccacgcccgcgaggatttt
ccggaccgcgacgatgccaactggatgaagcacaccttgctgtgggcagacccggtcaag
aagtcggtcacgatcgactaccggccggtgcacacctacacgctctccaacgacgtcgaa
tacatcgagccgaagaagcgcgtctattga

DBGET integrated database retrieval system