KEGG   Blastochloris viridis: BVIR_586Help
Entry
BVIR_586          CDS       T04109                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain, chromosomal
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bvr  Blastochloris viridis
Pathway
bvr00630  Glyoxylate and dicarboxylate metabolism
bvr01100  Metabolic pathways
bvr01120  Microbial metabolism in diverse environments
bvr01200  Carbon metabolism
Module
bvr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bvr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bvr_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BVIR_586
Enzymes [BR:bvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BVIR_586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ALK08383
UniProt: A0A0H5B826
LinkDB All DBs
Position
complement(637193..637582)
Genome map
AA seq 129 aa AA seqDB search
MRVTQGAFSFLPDLTDDQIKKQVAWCLDQEWAVSIEFTDDPHPRNTYWEMWGNPMFDLQD
PAGVMQELAACRAAHPDHYIRLNAFDSSRGWEAVRMSFIVQRPKVEPTFRLERTEVEGRT
QRYTLVTVR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagggtgccttttcgttcctgcccgacctcaccgacgaccagatcaag
aagcaggtcgcctggtgcctcgaccaggagtgggcggtgtcgatcgagttcaccgacgac
ccccacccccgcaacacctattgggagatgtggggcaacccgatgttcgatctccaggat
cctgcgggggtgatgcaggagctggcggcgtgccgcgccgcccaccccgaccactacatc
cgcctcaacgccttcgattccagccgcggctgggaggcggtgcggatgtccttcatcgta
cagcgccccaaggtcgagccgaccttccgcctggagcgcaccgaggtcgaaggccgcacc
cagcgctatacgctagtgacggtgcgctga

DBGET integrated database retrieval system