KEGG   Barnesiella viscericola: BARVI_05185Help
Entry
BARVI_05185       CDS       T02986                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bvs  Barnesiella viscericola
Pathway
bvs00473  D-Alanine metabolism
bvs00550  Peptidoglycan biosynthesis
bvs01100  Metabolic pathways
bvs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BARVI_05185
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BARVI_05185
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BARVI_05185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvs01011]
    BARVI_05185
Enzymes [BR:bvs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BARVI_05185
Peptidoglycan biosynthesis and degradation proteins [BR:bvs01011]
 Precursor biosynthesis
  Amino acid ligase
   BARVI_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AHF12271
UniProt: W0ET41
LinkDB All DBs
Position
1272591..1273772
Genome map
AA seq 393 aa AA seqDB search
MKTTVGVFFGGRSTEHEISVISALQAINAFNKDKYEIIPIYITKQGRWFSGDALLTVKNY
RDMAALQKMCTEVYMIPEYGDYNVYRKKKPLFGSNVWAKLDVVVPVLHGSNGEDGIFEGV
LESIGIPYAGCNTLASANGMDKITMKMIMQQSGIPIVDYVWFTDKQWFAQRDQLIEEIET
RLGYPVIVKPANLGSSVGISHADNREELIAKIDVAEKYSTRIVIEDMVEELKEINCSVLG
DCDDYRTSVCEEPIKSGDILTYEDKYMGGGKSNKGMQATQKRIPADLTPEETARVQFLAG
ETFRVLSCHGVARVDFMIDGKSGNIYVNEINTIPGSLSFYLWEASGIPFDQLMDRLVDLA
LKRKRESAMKTVSYDQNIFNLGKGLKGGKMGAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaccgttggtgtttttttcggaggccgctcgaccgagcacgaaatctccgtt
atctcggctttacaagccatcaatgcctttaacaaggataaatatgaaatcatacccata
tacatcaccaagcagggtcgctggttcagcggcgacgccctgctcacggtgaagaactac
cgcgacatggccgccctgcaaaagatgtgtaccgaggtctacatgattcccgaatatggc
gactacaacgtctaccgcaagaaaaagcccctcttcgggagcaacgtgtgggccaagctc
gacgtagtcgtgcctgtgctgcacggcagcaacggcgaggacggcatcttcgagggcgtg
ctcgaatccatcggcattccctatgccggttgcaacaccctggcctcggctaacggcatg
gacaaaatcaccatgaagatgatcatgcagcagagcggaatccccattgtcgactacgtg
tggttcaccgacaagcagtggtttgcccagcgcgaccagcttatcgaggagattgagacc
cgccttggctaccccgtcatcgtaaagccggccaacctgggttcgagcgtgggtatctcg
cacgccgacaaccgcgaagagctcatcgccaaaatcgacgtggccgagaaatactcgacc
cgcatcgtcatcgaggatatggtcgaggagctgaaagagatcaactgctcggtactgggc
gactgcgacgactaccgcacctcggtgtgcgaggagcccatcaagagcggcgacattctc
acctacgaagataaatatatgggaggcggcaaatcgaacaagggcatgcaggccacccaa
aaacgtatccccgccgacctcacccccgaggagaccgcccgcgtgcagttcctggccggc
gagaccttccgggtactctcgtgccacggcgtggcccgcgtcgacttcatgatcgacggc
aagagcggcaacatctacgtaaacgaaatcaacaccattcccggctccctctcgttctac
ctgtgggaggcatcgggtatccccttcgaccaactcatggaccggctggtcgacctcgcc
ctcaaacgcaaacgcgagtcggccatgaagaccgtcagctacgaccagaacatcttcaac
ctgggcaagggcctcaaaggcggcaagatgggggcgaagtaa

DBGET integrated database retrieval system