KEGG   Barnesiella viscericola: BARVI_05300Help
Entry
BARVI_05300       CDS       T02986                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bvs  Barnesiella viscericola
Pathway
bvs00473  D-Alanine metabolism
bvs01100  Metabolic pathways
bvs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BARVI_05300
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BARVI_05300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvs01011]
    BARVI_05300
Enzymes [BR:bvs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BARVI_05300
Peptidoglycan biosynthesis and degradation proteins [BR:bvs01011]
 Precursor biosynthesis
  Racemase
   BARVI_05300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase HHH_5
Motif
Other DBs
NCBI-ProteinID: AHF12286
UniProt: W0ET56
LinkDB All DBs
Position
1296014..1298482
Genome map
AA seq 822 aa AA seqDB search
MNYTTTQIATIVKAQKREYQDHIITALLTDSRSLTFPEETLFFALVTERNDGHRYIKELY
RKGVRDFVVEHPIPGEEEMEGANFIVVKDTLAALQQLAAAHRRRFNIPVIGVTGSNGKTT
VKEWLYQLLQPDYNTVRSPRSYNSQIGVPLSVWQIGPKTEMAIFEAGISQPDEMVHLEEI
IKPTLGLITNIGEAHQEGFQTIQQKCLEKLILLKACDCIIYDGDNSLICECVEKLCFGCR
EIAWSRKDRDKPLYISKITKGNDSTKIDYTYLQYHSSFTIPFVEDASIENAIHCLAVMLY
YNRPPEVIAERMARLTPVAMRMEVKEGINNCLIINDSYNSDINSLTIALDFQNRRAAAKG
MRRTLILSDIYQTGLPPASLYRKVADIILHKGIERLIGIGPVISDNAYLFNLEKEFYPST
ESFLSQFDPADFHNELILIKGAREFHFELISETLELKQHETILEVNLDAIVHNYNLFKSK
LHPQTKIICMVKAFGYGAGSYELAKTLQDRGADFLAVAVADEGAELRKAGITMPILVMNP
EMSSFRTLFSYYLEPEIYSFELLKAIIAEGEKLGLAGYPVHIKIDSGMHRLGFEEKDMPQ
VVDMLNDQTVVLARSVFSHFAGSDEPRFDEFSHQQIDTFTRCADYLQQHSKHKILRHILN
TAGILRFPEYQMDMVRLGIGLYGVSPIEDSCGIETVSTLKTTILQIKSLPAGETVGYGRK
GVLTRDSRIAAIPIGYADGLDRHLSNGKGCVVVNGKRAPIVGNICMDVCMIDVTDIDCQP
GDRVEIFGEQLPVTEIAETLGTIPYEILTSVSTRVKRIYYRE
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaactacacgactacccaaattgctacaatcgtcaaagcccagaaaagggaatatcaa
gatcatatcatcaccgcgctgctcaccgacagccggtcgctcaccttccccgaggagacg
ctcttctttgccctcgtgaccgagcggaacgacggccaccgctacatcaaggagctctat
cgcaaaggagtgcgcgactttgtggttgagcaccccattcccggcgaagaggagatggag
ggggccaacttcatcgtcgtcaaggatacgctcgccgccctgcaacaactggctgcggct
catcgtcgccggttcaatatcccggtcatcggggtcacgggcagtaacggcaagactacc
gtcaaggagtggctctaccagctgctccaacccgactacaacaccgtgcgttcgccccgc
agctacaactcgcagattggtgtaccgctctcggtgtggcaaatcgggcccaagaccgag
atggccatcttcgaggccggtatctcccaacccgacgagatggtacatctcgaagagatt
atcaaacccacgctgggactgattaccaacatcggcgaggctcaccaggaggggttccag
acaatccagcaaaagtgcctcgaaaagctcatcttgctgaaagcctgcgactgcattatc
tacgacggcgacaacagcctcatctgcgagtgtgtcgagaagctctgcttcggctgtcgc
gagattgcctggtcgcgcaaggaccgcgacaaaccgctttacatctccaagattaccaaa
gggaacgactcgaccaagattgactatacctacctgcaataccacagcagcttcaccata
ccctttgtcgaggacgcctcgatcgagaacgccatacactgcctggccgtgatgctctac
tacaaccgtccgcccgaggttatcgccgagcgtatggcccgcctcacgccggtagccatg
cgtatggaggtgaaggagggcatcaacaactgcctcatcatcaacgacagctacaactcc
gacatcaactcgctcaccatcgctctcgacttccagaaccgccgcgctgctgccaaaggc
atgcgccgcaccctcattctctccgacatctaccagacgggacttccccctgccagtctc
taccgcaaggtggccgacatcattctgcacaagggcatcgagcggcttatcggcatcggg
ccggtcatctcggacaatgcctacctcttcaacctcgaaaaggagttctacccctcgacc
gagagcttcctctcccagttcgatccggccgatttccacaacgagctgatattgatcaag
ggggcccgcgagttccatttcgagctcatctccgagaccctcgaactgaaacagcacgag
acgattctcgaagtcaacctcgacgccatcgttcacaactataacctgttcaagtcgaaa
ctgcacccccagaccaaaatcatctgcatggtcaaagccttcggctacggggccggatcc
tacgaactggccaagacgctgcaagaccgcggagccgactttctggccgtggccgtagcc
gacgaaggggccgaactacgcaaggcgggcataaccatgcctattctggtgatgaacccc
gagatgagcagcttccgcaccctgttcagctactacctcgagcccgagatatacagcttc
gagctgttgaaagccatcattgccgaaggcgagaaactggggctggccggctatcccgta
cacatcaaaatcgactcgggcatgcaccggctcggctttgaagagaaggatatgccccaa
gtagtcgacatgctcaacgaccagacggtcgtgctcgcccgctcggtattctcgcacttt
gccggtagcgacgagccccgcttcgacgagttctcgcaccaacagatcgacaccttcacc
cgttgtgccgactacctgcaacagcactccaaacacaagattctgcgccacatactcaac
acggccggcatcctgcgattccccgaataccagatggacatggtgcggctgggcatcggg
ctctacggcgtctcgcccatcgaagactcctgcggcatcgagacagtgagcaccttgaag
accaccattctccaaatcaagtcgctcccggccggcgaaaccgtgggctacggccgcaag
ggggtactcacccgcgactcacgcatcgccgccattcccatcggctatgccgacggtctg
gaccgtcatttgagcaacggcaaagggtgtgtagtggtgaacggcaagcgagcccccatc
gtgggcaacatctgcatggacgtatgcatgatcgacgtgaccgacatcgattgccagccg
ggcgaccgggtcgagatattcggcgaacagctgcccgtgaccgagattgccgagaccctc
ggcaccataccctacgagattctcacctcggtatcgacccgcgtaaaacgcatctattac
cgggagtaa

DBGET integrated database retrieval system