KEGG   Barnesiella viscericola: BARVI_06925Help
Entry
BARVI_06925       CDS       T02986                                 

Definition
(GenBank) type II restriction endonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
bvs  Barnesiella viscericola
Brite
Enzymes [BR:bvs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     BARVI_06925
Prokaryotic defense system [BR:bvs02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    BARVI_06925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: AHF12537
UniProt: W0EP45
LinkDB All DBs
Position
1675299..1676156
Genome map
AA seq 285 aa AA seqDB search
MRNFDTWLAGFRPSIADYKYYVDFDKVFNNVDAIRIPLNILNSLIRSKNIENDFKNILVQ
YPETLRCIPILLAKRELDIKAMDEEGQIDFHFDKPNCTNEDYVKFMRKTGLFDLMENHIV
NNLVDYVTGIETGLDSNGRKNRGGHLMENLVENFLCKAGLVKGVDYFKEMYIHEIEVKWK
IDLSSISNNGSSEKRFDFVVKGEKTIYGIETNFYTSSGSKLNETARSYKTITMETKDLGY
FKFVWFTDGCGWHSAKNNLKETFDVLEYLYNIADLESGIISRVLI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactttgatacttggcttgctggttttagaccttctattgccgattataaatat
tacgttgatttcgataaggttttcaataacgtggacgctattagaattccacttaatatc
ttgaattctcttattagatccaagaatatagagaatgacttcaaaaatattttggtacaa
tatccagaaactctaagatgtattcctatccttttagccaagcgagaacttgatattaag
gctatggatgaagagggacagattgattttcattttgataaaccaaattgcactaatgaa
gattatgtaaaattcatgagaaagaccggtctttttgatttgatggagaatcatattgtc
aataatcttgtggattacgtgactggtatagaaactggtcttgattccaacggacgcaag
aatcgtggtggtcatcttatggagaatcttgtagagaatttcctttgcaaagctggactt
gtgaaaggagttgactatttcaaggaaatgtatatccatgaaatagaggtcaagtggaaa
attgatttgtcttcgatttccaataacggtagctcagagaaaagatttgattttgtcgta
aaaggagaaaaaaccatttatggaatagaaacgaacttttataccagtagtggttccaag
ttgaacgaaacagcccgtagctataaaaccatcaccatggaaaccaaagatttgggatat
ttcaaatttgtttggttcaccgatggttgtggctggcacagtgcaaagaataatctgaaa
gagacctttgatgttttagagtacttgtacaacattgcggatcttgaaagtggaataata
tcaagagtacttatttaa

DBGET integrated database retrieval system