KEGG   Barnesiella viscericola: BARVI_09310Help
Entry
BARVI_09310       CDS       T02986                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bvs  Barnesiella viscericola
Pathway
bvs00564  Glycerophospholipid metabolism
bvs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BARVI_09310 (glpA)
Enzymes [BR:bvs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BARVI_09310 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Thi4 DAO_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHF12906
UniProt: W0EUZ2
LinkDB All DBs
Position
complement(2205599..2207218)
Genome map
AA seq 539 aa AA seqDB search
MNLNGKSNEYDVIIIGGGITGAGTARDCSLRGMRVLLLERFDFAAGATGRNHGLLHSGAR
YAVTDKESASECIKENMILRKIARHCVEENNGLFISLPEDDINFQSKFVESCHEAGIDAQ
IIDPAEARRIEPSVNPNLIGAVKVPDGSVDPFRLTLANIIDAKAHGAQILVYHEVTALIK
EQGRVIGVAVWDHKKKESTNYYAPLTINAGGIWGHNIAKMAGIEVGMYPAKGSLLIFGHR
VNNVVLNRCRKPADADILVPGDTICLIGTTSSHVGFDEVDDMRVTSEEVDLLLREGEKLA
PALATTRILRAYAGVRPLVAADNDPTGRNISRGIVLLDHETRDGVPGFATITGGKLMTYR
LMAEKATDLACAKLGIDKPCTTMNEPLPGSRNEEPESTDKKHATSPIRRSTIGRHGDLAA
RISTDNEVDNSLVCECEDVSVGEVKYALKELDVHNMEDLRHRTRVGMGTCQGELCACRAA
GLLSEAHNCAHQAKADLARFLNERWKGMYPVAWGEALREGEYTQWVYKGLCGMNKMEEK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcaacggcaaaagcaatgaatatgatgtcatcatcatcggaggtggcataacg
ggagcaggtacagcgagagactgttccttgcgaggtatgagagttttgctattggaacgt
ttcgatttcgctgcgggagcgacgggtcgcaaccatggcttgttgcacagcggagcccgc
tatgccgtcaccgacaaggaatcggcctcggagtgtatcaaggaaaacatgatactccga
aagattgctcggcattgtgtcgaagagaacaacgggctgtttatctctctacccgaagac
gatataaatttccaatccaaatttgtcgaatcgtgtcacgaagccggcatcgatgcccaa
atcatcgacccggccgaagcccgtcgcatagaaccctcggtcaaccccaacctgatcgga
gcggtcaaggtacccgacggctcggtcgatcccttccggcttaccttggccaacatcatc
gacgccaaggctcacggtgcccaaatactggtttatcacgaagtgacggctctcattaag
gagcagggccgcgtgataggcgttgccgtatgggatcacaagaaaaaagagtcgaccaac
tactacgccccgcttaccatcaacgccggtggtatctggggacacaacattgccaagatg
gccggaatcgaggtaggcatgtaccccgccaaaggttcgctgctcatcttcggccaccgg
gtcaacaacgtcgtactcaaccgttgccgcaaaccggccgatgccgacatcctggtaccc
ggcgataccatctgcctcatcggtaccacgtcgagccacgtgggatttgacgaggtcgac
gacatgcgggtaacctcggaagaggtcgacctgctgttgcgcgaaggcgagaaactggcc
ccagccctcgccaccacgcgtatcctgcgcgcctatgccggtgtgcgcccgctggtcgcc
gccgacaacgaccccacgggccgcaacatcagccggggcatcgtgctgctcgaccacgag
acccgcgacggagtgcccggctttgccaccatcacgggaggcaaactgatgacctaccgc
ctgatggccgagaaggccaccgacctggcctgtgccaaactgggtatcgacaaaccctgc
acgaccatgaacgagcccctgcccggttcacggaacgaggagcccgaatcgaccgacaag
aaacacgccaccagccccatcagacgttcgaccatcggccgccacggcgacctggctgcc
cggatttccaccgacaacgaggtggacaacagcctcgtatgcgaatgcgaagatgtgtcg
gtaggcgaagtaaaatatgctctgaaagagctcgacgtacacaacatggaggacctgcgc
caccgcacccgcgtgggcatgggtacctgccaaggcgaactctgcgcctgccgggccgcc
ggtctgctgagcgaggcgcacaactgcgcccaccaggccaaagccgacctggcccgattc
ctgaacgaacgctggaaaggcatgtaccccgtagcctggggcgaagcccttcgggaaggc
gaatatacccaatgggtctacaaaggattatgtggaatgaataaaatggaagagaaatga

DBGET integrated database retrieval system