KEGG   Barnesiella viscericola: BARVI_10590Help
Entry
BARVI_10590       CDS       T02986                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bvs  Barnesiella viscericola
Pathway
bvs00500  Starch and sucrose metabolism
bvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BARVI_10590
Enzymes [BR:bvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BARVI_10590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AHF13121
UniProt: W0EVL3
LinkDB All DBs
Position
complement(2482334..2484430)
Genome map
AA seq 698 aa AA seqDB search
MNVHIKLFAIALVLTSCSSTTENLLSPDGNIEIAFTLTDKGEPSYSAKYKGNDIVLPSLL
GFVLKDTTSLTDNFKITGIERSDFNESWTPVWGENDTIENCYTQMIVNLQQGDRKMDIEF
RAYNDGFGFRYIFPEQTAKAFVIADEATQIAMAGDHTAWWIPGDYDTQEYEYTTSRLSEI
RAHADDNFMNNASQQRFSPTGVQTALMLKTNDGLYLNLHEAALVDFPAMSLELNDTTMTF
KSHLTPGQGGTIATIHTPFKTPWRTITVGEKATDILASNLILNLNDPCILDDVSWIHPTK
YMGVWWEMITGKSSWSYTWADNFNLATFDYSKAKPNGIHGANNENVRRYIDFASEHGFDQ
LLVEGWNIGWEDWFGKEKDYVFDFVTPYPDFDIAALNDYAHRKGIKLMMHHETSSSVDNY
DRHMDAAYDLMKRYGYDTVKSGYVGNIIPKGEHHYSQKQVKHYLDAVKKAADKHIMVNAH
EAVRPTGLCRTYPNLVGNESAMGQEFADMSPQHCTILPFTRLKGGPMDFTPGIFRMKITD
FAPGGQGKQKRATIPNQLALYLTMYSPLQMAADMPEHYQKHMDAFQFIKDVPVDWSKSVY
LDAEPGDFIVVARKDKGSDAWYVGGVTDENARDYTLDYNFLPPGKTYEATIYADAPDGDG
FDNPEVYTITTKTVDSTSKDKIHMARGGGFAISIKPVD
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacatataaaattattcgctattgcccttgtccttaccagctgtagctctacc
actgaaaatctgctttcgccagacggcaatatcgagattgcctttactctcacagacaaa
ggcgagccatcctactccgcaaagtacaaaggcaacgacatcgttcttccttctttgctg
ggctttgtgcttaaagatacaacctctctaaccgacaatttcaagataacaggcatcgaa
cgctctgatttcaatgagtcatggacaccagtatggggcgaaaacgacactatcgagaac
tgttacacacagatgatcgtcaacctccaacagggcgaccggaaaatggacatagagttc
cgagcatataatgacggcttcggcttccgatatatattccctgagcagacggccaaagca
tttgtaatcgcagacgaagccacacagatagcaatggctggcgaccatacggcatggtgg
atccccggagattatgacacccaggaatatgaatacactacatcacgcctaagcgaaata
cgcgcacacgccgacgacaacttcatgaataatgcgtcgcaacaaagattctcacctacg
ggagtgcagacagccttgatgctaaaaaccaacgatggtctttatcttaatctccacgag
gcggcattggtcgacttccctgcgatgagtctcgaactcaatgacaccacaatgacattt
aaaagccatctcacgcccggacaaggcggtacgatcgcaactatacacactccctttaaa
acgccgtggcgcaccatcaccgtaggagagaaagcaactgacattctcgcatcaaatctt
attttaaatctgaacgatccatgtattctggacgacgtatcatggattcatcctaccaaa
tatatgggagtatggtgggaaatgattaccggcaaaagttcatggagctatacatgggcc
gataatttcaatcttgcgacttttgattattcaaaagccaaaccgaatggcattcatggg
gctaataatgagaatgtgcggagatatattgattttgcgtcagagcatggtttcgaccaa
cttcttgtcgaaggctggaatatcggttgggaggattggttcggcaaagagaaggactat
gtattcgattttgtcactccttaccccgactttgacatcgctgcactcaatgattatgcc
caccgcaaaggtatcaaattgatgatgcaccatgaaacttcctcttcggtcgataattat
gaccgccacatggacgccgcctacgacttgatgaagcgatacggctatgacacagtgaaa
agtggatatgtcggtaatatcatacctaaaggagaacatcattacagtcagaagcaggta
aagcactatctcgatgctgtaaaaaaagcagcagataaacatattatggtaaatgcccat
gaggctgtacgtccgacaggcctatgccgcacataccccaatctcgtaggcaacgaaagt
gctatgggacaggaattcgccgacatgagtccgcaacactgcaccatactgccttttacc
cgccttaaaggaggtcctatggacttcactccgggcatattccgtatgaagataaccgat
tttgcgcctggcggtcaaggtaaacagaagcgtgcgaccatccccaaccagcttgcattg
tatctcaccatgtacagccccttacaaatggctgcggatatgcccgagcactatcaaaag
cacatggacgcattccaatttatcaaagacgtaccggttgattggagcaaaagtgtatat
cttgatgcagaaccgggagattttatcgtagtcgcccgcaaagacaaaggcagcgatgca
tggtatgtaggaggcgttactgatgaaaatgcccgagactatacacttgattacaacttc
ctgccacccggtaaaacgtatgaagcaaccatttatgccgatgctccggatggcgatggc
ttcgacaatcccgaagtttataccattaccaccaagacggtagacagtacgtcaaaagac
aaaatccatatggctcgtggcggcggattcgcaatttcaataaaaccagtagattaa

DBGET integrated database retrieval system