KEGG   Bacteroides vulgatus: BVU_0391Help
Entry
BVU_0391          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 2, candidate beta-glycosidase
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ABR38109
UniProt: A6KXE5
LinkDB All DBs
Structure
PDB: 

Position
566286..568733
Genome map
AA seq 815 aa AA seqDB search
MKRILLFVCIQFFLLASFAGETINFCKGWKFHLGDAGKGASSSSYNDSQWRILNIPHDWS
IEGTYKQFENGTDWQSGFLPAGISWYRKTFTIPSKWKNKKVQILFEGVYLNSEVWINGHW
LGKRPNGYISFVYDLTPYLQEGKNQIAVKVDHSKALTGRWYTGSGIYRPVYLLVSNPTHI
PYSGIHFRSKLQNKQSATYTLSIEIETQEKKPIKVKTYLQAPNGSIADTSEKIFVSSADS
LCFLSGSIRKPLLWSPDSPNVYTLICQLTRDNKILDECRLPVGFRQLEFNPVSGFLLNGK
SLKIKGVCDHHTVGAVGAAVPDDLLHYRLKLLKDMGCNAIRTSHNPFSPAFYNLCDTMGI
MVLNEGLDGWNQPKAADDYGNYFDEWWQKDMTDFIKRDRNHPSIIMWSIGNEVTGATPEI
QHNLVSLFHQLDPDRPVTQGGTDPTRGMKTDYQKKFNYLDIIGFNGNGEEIGELEHFHKN
YPTLCAIATEVPHTYQTRGVYRSQTQWRRRDFPAPWEKGNINWEQFKHRVFPIPDLTEKE
CFPEESDYPYYQSSYDNASVRISARKSWQRTCSFPWLMGEFRWGSFDYLGEAEWPQRCGN
FGIIDIAAIPKDAYFLYQSLWTDKPMVHLLPHWTHPGKEGKTIPVVIYTNCDAVELFINN
VSLGSKPYTGEQLIWLVPYSPGKIEARGIKKGKIVATDCYQSAEAPHSVALASNKYSVKA
GSDEVIRIEIDITDKNGIPCPYASNELSFHVSGPLRLLGVDNGNPTDMFPYQQPHCRCFR
GKCVVLLQSDEEKGKGTLTVQGTKLVEKKLIIEVI
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatccttttatttgtttgcatacaatttttcttattggcatcttttgccgga
gaaaccataaatttctgtaaaggctggaaattccatctaggagatgcaggcaaaggagcc
tcttcttcctcatataacgattctcaatggcgcatattgaatattcctcatgactggagc
atagaaggcacttataaacaatttgaaaacggaaccgactggcaaagcggcttcctgcct
gccggaataagctggtatcgaaaaacttttaccattccttccaaatggaaaaataaaaaa
gtacaaatcctatttgagggcgtatatctgaacagcgaagtatggataaacggtcattgg
ctgggcaaacgtcctaatgggtatatcagctttgtatatgatttaactccatatttgcaa
gaaggcaagaaccaaatcgctgtaaaagtagatcacagcaaagcattaaccggacgttgg
tatacaggatcaggaatatatcgtcctgtatacctgctggtcagtaaccccacccacatt
ccttattccggaatccatttcagatccaagctacaaaataagcaatctgccacctacacc
ctatctatagaaattgaaacacaggagaaaaagccaatcaaagtaaaaacatatctacaa
gctcccaacggtagcatagccgatacttctgaaaaaatatttgtctcatctgcagattct
ctttgcttcctgtcagggagcatcaggaaaccattattatggtcgcctgattctcctaac
gtctatacacttatatgccaactgacaagagataacaagatactagatgaatgtagatta
cctgtaggcttccgtcaattagaattcaacccggtcagcggattcctgctcaatggcaaa
tcactaaagataaaaggagtatgcgatcatcatacagtcggtgctgtaggagccgccgta
cccgacgacctacttcattatcgtctcaaattattgaaagatatgggatgtaatgcgata
cgcaccagtcataatcccttctctcctgctttctataatttatgcgatacgatgggaatc
atggtactaaacgaaggattggacggatggaatcaacctaaagccgccgatgactatgga
aattactttgatgaatggtggcaaaaagatatgactgatttcataaaacgagaccgtaac
catccctctatcattatgtggagtatcggcaacgaagtaacgggagctacccccgaaatc
caacacaacctggtcagcctatttcaccaactggaccctgaccgccctgtcactcaagga
ggaactgatcctactagaggtatgaagaccgattatcaaaaaaaattcaactatctagac
attatcggcttcaatggaaatggagaagaaataggagaactagaacacttccacaaaaac
tacccaacactttgtgccattgctacagaggtaccgcacacttatcaaacccgtggcgta
taccgaagccagacacaatggagaagacgggatttccccgctccttgggaaaaaggaaac
ataaactgggaacaatttaaacatcgggtctttcctatacctgacctgacggaaaaagaa
tgcttccccgaagaatccgattatccctattatcaatcgtcctacgacaatgcttctgta
cgtatcagcgcccgtaaatcatggcaacgcacctgttctttcccttggttaatgggagaa
ttccgatggggcagttttgactatttaggtgaagccgaatggcctcaacgatgtggcaat
ttcggtattatcgacatagctgccattccgaaagacgcctatttcctctaccaaagttta
tggaccgacaaaccaatggtacaccttcttccgcattggacgcatccgggaaaagaagga
aaaacaattcccgtagtcatttataccaactgtgatgcagtagagttatttataaataat
gtatctttgggcagtaaaccttatacaggggagcaactgatatggttagttccttattcg
cccggaaaaatagaagcccgaggcataaaaaaaggaaaaatcgtggcaacagactgttat
caaagtgcagaagcacctcattctgtcgcccttgccagtaacaagtattctgtaaaagcc
ggttcggatgaagtcatacgcatagagatcgacataacagataaaaacggaattccttgt
ccttatgcctccaatgaactcagtttccacgtaagtggaccactccggctattaggggta
gacaacggaaaccctacagatatgtttccataccaacagccccactgccgttgctttcgg
ggaaaatgtgtagtattattacaatctgacgaagaaaaaggaaaaggaaccctgactgta
caaggaacaaaattagtagaaaaaaaattaatcatcgaagtgatatga

DBGET integrated database retrieval system