KEGG   Bacteroides vulgatus: BVU_1381Help
Entry
BVU_1381          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 97, candidate alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00500  Starch and sucrose metabolism
bvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BVU_1381
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BVU_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ABR39070
UniProt: A6L056
LinkDB All DBs
Position
complement(1845222..1847438)
Genome map
AA seq 738 aa AA seqDB search
MNLKKNLSLIAFLCISFIANAQQKLNSPDGNLEMTFTLDGQGTPTYELTYKQKEVIKPSK
LGLELKKEDANAKTDFEWTDKKDIDKLDIKTNLYNGFEIKDVRTSTNDETWQPVWGEEKE
IRNHYNELAVTLNQPANDRFIIIRFRLFNDGLGFRYEFPQQKDLNYFVIKEEHSQFAMAG
DHTAYWIPGDYDTQEYDYTVSRLSEIRGLFSKAYTENSSQTAFSPTGVQTALMMKTDDGL
YINLHEAALIDYACMHLNLDDKNMIFESWLTPDAQGDKGYMQTPCTSPWRTVIVSDDARN
ILASRITLNLNEPCKIADTSWIKPVKYIGVWWDMITGKGSWAYTDDLSSVKLGETDYNKT
KPNGKHSANTANVKRYIDFAAEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFNV
KELQSYAASKGVKLMMHHETSASVRNYERHMDQAYQFMVDNGYNSVKSGYVGNIIPRGEH
HYGQWMDNHYLYAVKKAADYKIMVNAHEAVRPTGICRTYPNLIGNESARGTEYESFGGNN
VNHTTILPFTRLIGGPMDYTPGIFETRCNKMNPTNNSQVRSTLARQLALYVTMYSPLQMA
ADIPENYERFMDAFQFIKDVAIDWDETKYLEAEPGDYITIARKAKGTNDWYIGCTADENG
HSSKLIFDFLDPDKKYIATVYADAKDADWKDNPQAYTIRKGIVTNKSKLNLHAASGGGYA
ISIKEVKDKSELKGIKRL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaaaagaatctttcacttatcgcatttctctgtatctcattcattgcaaat
gcacaacaaaaactgaattctccggatggtaatctggagatgacatttactctagatggt
cagggcactcccacgtatgaactgacctataaacaaaaggaagttatcaaacccagtaaa
ttggggttggaattaaaaaaagaagacgcaaacgccaaaaccgacttcgaatggactgat
aaaaaagacatagacaaactggacatcaagacaaacctttataacggtttcgagataaag
gatgtccggacatctaccaacgatgaaacatggcagccggtatggggagaagaaaaggaa
atccgtaaccattataatgaattggcggtcacattgaaccagcctgccaatgacagattt
ataatcatccgtttccgcctgttcaacgacggtctgggtttccgctatgaatttccgcag
cagaaggacttgaactatttcgtgatcaaagaagaacattcacaatttgccatggcaggt
gaccacaccgcttactggattccgggagattatgacacacaggaatatgactataccgtt
tcccgcctgtcggaaatcagaggattgttttcaaaggcttatacggagaactcctcgcaa
accgcattcagccccaccggtgtacaaactgccctgatgatgaaaacagacgacggtctg
tacatcaatctgcacgaagcagctttgatagactatgcctgcatgcacctcaacctggat
gacaagaacatgattttcgaatcatggctgactccggatgcacaaggtgacaaaggatat
atgcagactccctgcacttcaccatggcgtaccgtcatcgtcagtgatgatgcccgcaac
attcttgcctcacgcattacgttaaacctgaacgaaccttgcaaaatagcagacacttcc
tggatcaagcctgtgaaatacatcggtgtgtggtgggatatgattacgggaaaaggctca
tgggcttacacggacgacttatccagtgtaaaactgggtgaaacagattacaacaaaaca
aaacctaacggcaaacactctgccaacactgccaacgtaaaacgttacattgattttgca
gcagagcatggattcgaccaagtattggtagaaggctggaatgaaggttgggaagactgg
ttcggaaaaagcaaagattatgtgtttgattttgtaactccctatcccgacttcaatgtg
aaagaacttcaaagctacgctgcaagcaaaggcgtaaaactgatgatgcatcatgaaact
tcggcttctgtacgtaactatgaacgccacatggaccaggcataccaattcatggtagac
aacggatataattctgtaaaaagtggctatgtaggcaacattattccacgtggcgaacac
cactatggacaatggatggataaccactatctgtatgcggtgaaaaaagcagcggactac
aaaatcatggtaaacgcccacgaagctgtacgccctaccggaatatgccgcacctatccc
aacctgatcggtaacgaatcggcacgcggaactgaatatgaatcatttggcggtaacaac
gtaaaccatactaccatcttgcctttcacacgattaataggtggtccgatggactacact
ccgggtatctttgaaacccgctgtaacaaaatgaatcctaccaacaattcacaggtacgt
tctactttggcacgccaactggccctgtatgtaacaatgtacagcccattacaaatggct
gccgacatacctgaaaactatgaacgcttcatggatgccttccaattcataaaagatgta
gccattgactgggatgaaaccaaatatctggaagccgaaccgggagactatattaccatt
gcccgcaaagctaaaggaaccaacgactggtatatcggctgtacggcagatgagaacggt
cattcttcaaaactgatatttgatttccttgatccggacaaaaaatacatcgcaactgta
tatgcagacgcaaaagatgccgactggaaagataatccgcaggcatataccatccgtaaa
ggcattgtgaccaacaaaagcaaactgaacttacacgcagcaagcggtggtggttatgca
atcagcattaaagaggtaaaagataaatcagaattaaaaggtattaagagattatag

DBGET integrated database retrieval system