KEGG   Bacteroides vulgatus: BVU_1765Help
Entry
BVU_1765          CDS       T00546                                 

Definition
(GenBank) putative alanine racemase and UDP-N-acetylmuramoylalanyl-D-glutamyl, 6-diaminopimelate-D-alanyl-D-alanyl ligase fusion protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00473  D-Alanine metabolism
bvu01100  Metabolic pathways
bvu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BVU_1765
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BVU_1765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvu01011]
    BVU_1765
Enzymes [BR:bvu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BVU_1765
Peptidoglycan biosynthesis and degradation proteins [BR:bvu01011]
 Precursor biosynthesis
  Racemase
   BVU_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ABR39441
UniProt: A6L177
LinkDB All DBs
Position
2262873..2265338
Genome map
AA seq 821 aa AA seqDB search
MSSSIENIEKVLGAKRFGDRSAQIDWILTDSRSLCFPEETLFFALKTKRNDGHKYLPELY
ERGVRNFVVGELPADMKSFQDANFLQLANPLKGLQKLAEKHREQFQIPVIGITGSNGKTI
VKEWLYQLLSPDRVVTRSPRSYNSQIGVPLSVWLMNERTELAIFEAGISEMGEMEALQTI
IKPTVGILTNIGGAHQENFFSLQDKCMEKLTLFKDCDVIIYDGDNELISSCVAKSLFTSR
EIAWSKKDNERPLFIESIQKGAHATTIKYRYLGMPNEFSIPFIDDASIENSLHCLAVALY
MMVSPEQITERMARLEQIAMRLEVKEGKNGCVLINDSYNSDLASLDIALDFMSRRSDDKG
KKRTLILSDMLETGQSGKLLYRQVAELVHSRGVEKIIGVGEEIRTAAARFEIEKYFFRTT
EELLESDLLAGLRNEVILVKGSRAFHFDRISDRLELKVHETILEINLNALVDNLNYYRSK
LKPETKMVCMVKASAYGAGSYEIAKTLQDHRVDYLAVAVADEGSDLRKAGITCSIMIMNP
ELTAFKTMFDYKLEPEVYSFHLLNELIKAAEKEGVTNFPIHIKLDTGMHRLGFAPEEIPE
LIDRLKKQTAVIPRSVFSHLVGSDGAQFDSFTRRQIEMFEAASECLQEAFQHKILRHICN
TAGIERYPGAQFDMVRLGIGLYGIDPFTNQIIHNVSTLKTTILQIHEVPKEETVGYSRKG
HLERDSRIAAIPIGYADGLNRRLGNGHAYCLVNGQKAPYVGNICMDVCMIDVTDIDCKEG
DKTIIFGDDLPVTVLSEILETIPYEILTSVSNRVKRVYYQN
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcgattgaaaatatagaaaaagttctgggagcaaagcggtttggggaccgt
agtgcacagattgattggattttaactgatagccgttcattgtgctttccggaagaaaca
ttattttttgctttaaaaaccaaacggaatgacgggcataaatatcttccggaattgtat
gaacgtggagtccgtaattttgtagtgggcgaattgccggccgatatgaaatcttttcaa
gatgcgaatttcctgcagttggccaatcctctgaaaggattacagaaattggcggaaaag
catcgggagcagtttcagattccggttataggaattacaggcagcaatggaaaaaccatt
gtgaaggaatggttgtatcaattgctgagcccggaccgtgtggtaacccgttcgccacgt
agctataattcacagataggtgtgccactttcggtatggttgatgaatgaacgcactgag
ttggctatttttgaagcgggtatttccgaaatgggggaaatggaggcgttgcagactatc
attaaacctactgtggggattttgactaatattggtggtgcgcaccaagagaactttttc
tctttacaggataaatgtatggagaagcttactttgttcaaagactgtgacgtcatcatt
tatgatggcgataacgaactgatcagttcgtgtgtggcaaaatctctttttacctcgcgt
gagattgcttggtcgaaaaaggacaatgaacgtccgttgtttattgagtccattcaaaaa
ggggcacatgctaccactattaaataccgttatctggggatgccgaatgaatttagtatt
ccttttatagatgacgcttctattgagaattcgctgcattgtctggctgtggctttgtat
atgatggtttcccctgaacaaataaccgagcgcatggcgcgtttggaacagattgctatg
cgtctggaggtaaaagagggcaagaatggctgtgtgttgatcaatgatagttataattcg
gatttggcttctttggatattgctcttgactttatgtcgcgtcgttctgatgataaagga
aaaaaacggacacttatcctctcggatatgcttgaaacaggccagagcggcaaactgctt
tatcgtcaggtagccgaattggtacatagccggggagtagagaagattatcggggtagga
gaggaaattcggactgctgctgcccgttttgagatagaaaagtattttttccgtactaca
gaagaactgttggagtcggatttgctggctgggctgcgtaatgaggtgattttggtaaaa
ggttcgcgggcttttcattttgaccggatttcagatcgtttggaactgaaagtgcatgaa
accattttggagatcaatttgaatgctttggttgataacttgaattattatcgcagcaaa
ctgaaaccggaaacaaaaatggtatgtatggtgaaggcttctgcatacggtgccggttca
tacgagatagctaagacactgcaagatcatcgtgtggattacttggcagtagctgtggct
gatgaaggttcggatctgaggaaagcgggaattacctgttccattatgattatgaatcct
gagttgacagcattcaagaccatgtttgattataaattggaacccgaggtttacagtttc
catttattgaatgaactgattaaagctgccgaaaaagaaggggtaacgaatttccccatt
catattaaattggatacgggaatgcaccgtttgggttttgcacccgaagagattccggaa
ctgatagaccgtctgaagaaacagacagctgttattccacgttctgtattctcccatttg
gtaggcagtgacggggctcagtttgattcgtttacgcgcagacagatagaaatgtttgaa
gctgcttctgaatgtttgcaggaggcttttcagcataagatattgcgtcatatctgtaat
acagccgggatagaacgttatccgggtgctcagttcgatatggtgcgtttgggaatcggt
ctttatggaattgatccgtttaccaatcagatcatccataatgtaagtacattaaaaacc
actattcttcagattcatgaggttcctaaggaggaaacagtggggtatagtcgtaaagga
catttggaaagggattcccgcattgccgctattcctatcggctatgccgacgggctgaac
cgacgtttgggaaatggacatgcctactgtttggtgaatgggcagaaagcgccatacgtg
ggtaatatctgtatggatgtatgcatgattgatgtgacggatattgattgtaaggaaggg
gataaaactatcattttcggagatgatttaccggtcactgtcctgtcagagattctggaa
actattccatacgagatcttgaccagtgtgtctaatagggtaaaacgagtttattaccag
aattaa

DBGET integrated database retrieval system