KEGG   Bacteroides vulgatus: BVU_4143Help
Entry
BVU_4143          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 33, candidate sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00511  Other glycan degradation
bvu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BVU_4143
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BVU_4143
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bvu02042]
    BVU_4143
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BVU_4143
Bacterial toxins [BR:bvu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BVU_4143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_2 BNR_3 BNR Sortilin-Vps10 End_beta_propel
Motif
Other DBs
NCBI-ProteinID: ABR41745
UniProt: A6L7T1
LinkDB All DBs
Position
complement(5102345..5103985)
Genome map
AA seq 546 aa AA seqDB search
MRNPSLLLLIVVFILAPFKLSAAADTVVVRETRIPVLIERQDNELFHLRIEATQSQMLNE
VKLDFGKDVNLNEIESVKLYYGGTESVERRGKTYFAPVDYISNNTPGKTLAANTSYSVLK
SEVKAPKREVVLKADQKLFPGVNYFWISLQMKPVASILSKVSAEVVEAKIDGQVAPLKIA
RKADTHYMGIGVRHAGDDGAAAYRIPGLATSNKGTLLGVYDVRYNNSADLQEYVEIGLSR
STDGGQTWEKMRIPMAFGEYDGLPKAQNGVGDPAILVDKKTGTIWIVAAWTHGMGNGRAW
WNSQTGMDRNHTAQLMMVKSDDDGKTWSEPMNITEQVKDPSWYFLLQGPGRGISMEDGTL
VFASQYIGNDRIPNAGIIYSKDHGKTWNISTLARTNTTESQVAEVEPGVLMLNMRDNRGG
SRAVSTTTDLGKTWKEHESSRTALQEPVCMASLISVKAKENVLGKDILLFSNPNDAKNRH
SITIKASLDGGVTWLPENQLLLDAGWGWGYSCLTMIDKETVGILYESSVAHMTFQAIKLK
DIIKTK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccctagcttattactgctaattgttgtttttatattagcacccttcaagttg
agtgcggcggcagatacggttgttgtccgcgaaacccggattcctgtgttgattgaaagg
caggataatgagttgtttcatttacgtatagaggctactcaaagtcagatgctgaatgaa
gtgaagttggacttcggcaaagacgtgaatttgaatgaaattgaatctgtgaaactgtat
tatggtggaactgaaagcgtggagaggaggggaaagacttattttgctccggtagattat
atatctaataatactccgggaaaaacattggctgccaatacttcttattccgttttgaag
tcggaagtgaaggccccgaagcgtgaggttgtattgaaagctgaccaaaaattgtttccg
ggagtgaattatttttggattagcctgcaaatgaagcctgttgcttctatcttgtccaaa
gtgtcggcagaagtggtggaagctaagattgacggacaggttgctcctttgaagatagcc
cgtaaggcggatacccattatatggggatcggcgtgcgtcatgccggtgacgacggggct
gctgcctatcgtattcccggattggccacttcaaataaaggaaccttgttgggggtatat
gatgtacgctataataatagtgcggatttacaggagtatgtggaaataggtctgagcaga
agtacggacggaggtcagacttgggagaaaatgcgcattccgatggcatttggtgaatat
gatgggttgcctaaagcacagaatggagtaggcgatccggccattttggttgataagaag
acaggaactatctggattgtcgctgcctggacacatggtatgggaaatgggcgtgcgtgg
tggaattcacaaacaggcatggaccgtaatcatacagcacaattaatgatggtgaaaagt
gatgatgatggtaagacctggtcggagcctatgaatataacagaacaggtgaaagatccg
tcatggtatttcttgctgcaaggtcccggtagaggtatctctatggaagatggaacattg
gtctttgccagccagtatattggcaatgaccgtattcctaatgccggtattatatacagt
aaggatcatggaaaaacctggaatatcagtacattggcacgcactaatacaactgaatct
caggtagcggaagtggaaccgggagtgctgatgctgaatatgcgtgataatcgtggtggc
agtcgtgccgtttctacaactacagatttaggtaaaacatggaaagaacatgagtcttca
cgtacagccttacaggaaccggtttgtatggccagtttgattagtgttaaagctaaagag
aatgtattgggtaaagacatccttttgttctctaatccgaatgatgccaagaaccgtcat
agcattaccatcaaagcaagtctggatggtggggtgacttggttgcccgagaatcaattg
ctgctggatgccggttggggttggggatacagctgcttgactatgattgacaaggaaaca
gtaggaattttatatgaaagcagtgtggcccacatgactttccaagcgataaagctgaaa
gatattattaagaccaaataa

DBGET integrated database retrieval system