KEGG   Bosea vaviloviae: BHK69_08220Help
Entry
BHK69_08220       CDS       T04483                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bvv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BHK69_08220
Enzymes [BR:bvv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BHK69_08220
Transporters [BR:bvv02000]
 Other Transporters
  Pores ion channels [TC:1]
   BHK69_08220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AOO80449
UniProt: A0A1D7TZ99
LinkDB All DBs
Position
1763552..1764184
Genome map
AA seq 210 aa AA seqDB search
MSDELVLYTNPMSRGRIARWMLEEVGAPYRAEILGFGPPMKGAYKAVNPMGKVPALKHGD
MVVTECAAICAYLADAFPQAGLAPEPGSKLRGPYYRWLFFGAGPTEAAVSNKALGFEVPA
DRARMIGYGSFTDVMDTLEQAVTAGEYLLGDRFSAADVYLGSQILWGLQFGSIEKRPAFD
AYGKRISGRPAALRADEIDDALIAEQQKQA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgagctcgtgctctacaccaacccgatgtcgcgcggccggatcgcgcgctgg
atgctggaggaggtgggcgcgccctaccgcgccgagatcctgggtttcggcccgccgatg
aagggcgcctataaggcggtcaatccgatgggcaaggtgccggcgctgaagcatggcgac
atggtcgtcaccgaatgcgccgcgatctgcgcctatctcgccgacgccttcccgcaggcc
ggcctcgcgccggagcccggcagcaaattgcgcggcccctattaccgctggctgttcttc
ggcgcggggccgacggaggcggcggtgagcaacaaggcgctcggcttcgaggtgcccgcc
gacagggcccggatgatcggctatggcagcttcaccgacgtcatggacacgctggagcag
gcggtgacggcgggtgaatatctgctgggcgaccgtttcagcgcggccgatgtctatctc
ggttcgcagatcctctggggcctgcaattcggctcgatcgagaagcgcccggccttcgac
gcctatggcaagcgcatctccggccgcccggcggcgctgcgggccgacgagatcgacgat
gccctgatcgcggagcagcagaagcaggcctga

DBGET integrated database retrieval system