KEGG   Bosea vaviloviae: BHK69_13075Help
Entry
BHK69_13075       CDS       T04483                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
bvv  Bosea vaviloviae
Pathway
bvv00910  Nitrogen metabolism
bvv02010  ABC transporters
Module
bvv_M00438  Nitrate/nitrite transport system
bvv_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BHK69_13075
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BHK69_13075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvv02000]
    BHK69_13075
Transporters [BR:bvv02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BHK69_13075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AOO84428
UniProt: A0A1D7UAM6
LinkDB All DBs
Position
2814551..2815459
Genome map
AA seq 302 aa AA seqDB search
MGQTVLKNATAGAKVVALAAVQAEVVTLPAVAGKPLRERLGAWLKAVLVNILPPLITVTL
ILLVWQLTAHGPQSSLPPPTKIWAEAKDLITEPFFWNGSQDIGLGWRILVSLQRVAIGFS
LAAVVGVLLGALVGQSVWAMRGLDPVFQVLRTVPPLAWLPLSLAAFRDSQPSAIFVIFIT
AIWPVIINTAVGIRNIPQDYRNVAQVLRLNQIEFFFKIMVPSAAPYIFTGLRIGVGLSWL
AIVAAEMLTGGVGIGFFIWDAWNSSRLSDIIVALIYIGVVGFVLDRFVAFVGTIVTRGTL
TN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagactgtcttgaagaatgcgactgcgggcgcgaaggtcgtcgcgctggcggcc
gtgcaggccgaggtggtgaccctgccggcggttgcgggcaagccgctgcgcgagcggctc
ggcgcctggctcaaggcggttctcgtcaacatcctgccgccgctgatcacggtcacgctg
atcctgctggtctggcagctcaccgcgcatggcccgcaatcctcgctgccgccgccgacc
aagatctgggcggaagccaaggacctgatcacggaaccgttcttctggaacggctcgcag
gatatcggtctcggctggcgcatcctggtctcgctccagcgcgtcgccatcggcttcagc
ctcgcggcggtcgtcggcgtgctgctgggggcgctcgtcggccagtcggtctgggcgatg
cgggggctcgatccggtcttccaggtgctgcgcaccgtgccgccgctcgcctggctgccg
ctctcgctggcggcgttccgtgacagccagccctcggcgatcttcgtgatcttcatcacc
gcgatctggccggtgatcatcaacacggcggtcggcatccgcaacatcccgcaggattac
cgcaatgtcgcgcaggtgctgcggctgaaccagatcgagttcttcttcaagatcatggtg
ccctccgccgcgccctacatcttcaccgggcttcgcatcggcgtcggcctgtcctggctc
gccatcgtcgcggccgagatgctgaccggcggcgtcggcatcggcttcttcatctgggat
gcgtggaactcctcgcgtctgtccgacatcatcgtggcgctcatctacatcggcgtcgtc
ggcttcgtgctcgatcgcttcgtcgccttcgtcggcaccatcgtcacccgtggcaccctg
accaactga

DBGET integrated database retrieval system