KEGG   Bosea vaviloviae: BHK69_15730Help
Entry
BHK69_15730       CDS       T04483                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BHK69_15730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bvv01007]
    BHK69_15730
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bvv03016]
    BHK69_15730
Enzymes [BR:bvv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BHK69_15730
Amino acid related enzymes [BR:bvv01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BHK69_15730
Transfer RNA biogenesis [BR:bvv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BHK69_15730
 Prokaryotic type
    BHK69_15730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f DALR_2 tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AOO81711
UniProt: A0A1D7U2W1
LinkDB All DBs
Position
3406568..3408037
Genome map
AA seq 489 aa AA seqDB search
MSPILRLYNTLTRTKEVFAPIDPDNVRMYVCGPTVYDYAHIGNARPVIVFDVLYRLLRHL
YGANHVTYARNLTDVDDKINARAARDYPGLPLNQAIAKVTQATTAQFHADIGALGNLPPD
AEPRATDHIEEMKAIIERLIARGVAYVAEEHVLFHVPAVEHLKAAPKYGSLARRPLDEMI
AGARVDVAPYKRDPMDFVLWKPSREGIDPGWPSPAGIATPGRPGWHIECSAMSMAKLLSP
FGGGLACDDPAKNLFDIHGGGIDLVFPHHENEIAQSCCAFGGVDGAGRMANIWMHNGFLQ
VEGEKMSKSLGNFVTINELLETEVFGGRTWPGEVLRLAMLKTHYRQPIDWTVKALEEAEK
TLAEWSDVAGDAEVGSPSQAFLDALADDLNIAKALAELHALRKAGELSRLRGGLSLLGIG
LRSQSNALDNATLRAAVDMQIAARLEARRAKNFAESDRIRDALLAQGIQLKDGKDPATGE
PTTTWDVKR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatcttgaggctctacaacacgctgacgcggacgaaggaggttttcgctccg
atcgatcccgacaatgtccgcatgtatgtctgcggcccgacggtctatgactatgcccat
atcggcaatgcccgcccggtcatcgtcttcgacgtgctctaccggctgctgcggcatctc
tatggcgcgaaccatgtcacctatgcccgcaacctcaccgacgtcgacgacaagatcaac
gcgcgggcggcccgcgactatcccggcctgccgctgaaccaggcgatcgcgaaggttacg
caagcgaccacggcgcagtttcatgccgatatcggcgcgctcggcaacctgccgcccgac
gccgagccacgtgcgaccgaccatatcgaggagatgaaggcgatcatcgagcgcctcatc
gcgcgcggcgtcgcctatgtcgcagaagagcatgtgctgttccatgtgcccgccgtcgaa
catctcaaggccgcgccgaaatacggttcgctggcgcgccggccgctcgacgagatgatc
gccggggcacgggtggacgttgctccgtacaaaagagatccgatggatttcgtgctgtgg
aagccgagccgcgaagggatcgatcccggctggccatcgccggccggcatcgccacgccc
ggccgccccggctggcatatcgaatgctcggccatgtcgatggcaaagctgctctcgcct
ttcggcggcgggcttgcctgcgacgacccggccaaaaacctcttcgacatccatggcggc
ggcatcgacctcgtcttcccgcatcatgagaacgagatcgcccaatcctgctgcgccttt
ggcggcgtcgacggggcagggcgcatggccaatatctggatgcataacggcttcctgcag
gtcgagggcgagaagatgtcgaaatcgctcggcaacttcgtcaccatcaacgaattgctg
gagaccgaggtctttggcgggcggacatggccgggcgaagtgctgcgccttgccatgctg
aagacgcattaccgccagccgatcgactggacggtgaaggcgctggaggaggcggagaag
acgcttgccgaatggtcggatgtcgccggcgatgcggaggtcggatcgccttcgcaagcc
ttcctggacgcgttggcggatgatctgaacatcgccaaggcgctggccgagctgcatgcg
cttcgcaaagcaggcgagctgtctcggctgcgcggaggactgtcgctgctcggcatcggc
ctgcgttcccagagcaacgcgctggacaacgcaacgcttcgtgctgctgtcgacatgcag
atcgccgctcgtctcgaagcccgccgcgccaagaacttcgccgaatccgaccgcattcgc
gacgcgcttctggcgcaaggcatccagctcaaagatggcaaggaccccgccaccggcgag
ccgacgacgacatgggacgtgaaacgatga

DBGET integrated database retrieval system