KEGG   Bosea vaviloviae: BHK69_16130
Entry
BHK69_16130       CDS       T04483                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bvv  Bosea vaviloviae
Pathway
bvv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BHK69_16130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvv02044]
    BHK69_16130
Secretion system [BR:bvv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BHK69_16130
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AOO81775
UniProt: A0A1D7U339
LinkDB
Position
complement(3487924..3488409)
AA seq 161 aa
MAEDIFLKIESDKVDGESADKGHKGELEIQSWSWGVSNAGSAHRGTGAGTGKASFSDASF
MMTMDKAAPILMQSSGTGVHHKKCTLTQRRAGGKEQVEFIKLTMEDVLVSSVQLSSSSQD
AMVSFTLNFAKFKIEYTPQAASGGKDAKTEFSYNIAENATA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggccgaagacatctttctcaagatcgaatccgacaaagtcgacggcgagtcggccgac
aaggggcacaagggcgaacttgagatccaaagctggagttggggcgtctccaacgccggc
agcgctcatagaggtactggagcgggaacaggcaaggcttcgttctcggacgcctcgttc
atgatgacgatggacaaggcagctcccattctgatgcagagctctggaacgggcgtccac
cacaagaaatgcacgctgacgcagcgaagggccggcggtaaggagcaggtggaatttatc
aaattgacgatggaggacgtgctcgtcagttcggtccagctgagcagttcatcgcaggac
gcgatggtgagcttcacgctcaactttgccaaattcaagatcgagtatacgccgcaggct
gcatcgggcggtaaggacgcaaagactgaattcagctataacattgccgagaacgccacg
gcctga

DBGET integrated database retrieval system