KEGG   Bosea vaviloviae: BHK69_23265Help
Entry
BHK69_23265       CDS       T04483                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00564  Glycerophospholipid metabolism
bvv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BHK69_23265
Enzymes [BR:bvv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BHK69_23265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored Pyr_redox FAD_binding_2 GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOO82973
UniProt: A0A1D7U6H4
LinkDB All DBs
Position
5067121..5068647
Genome map
AA seq 508 aa AA seqDB search
MKNAEPAYDLAVIGGGINGCGIARDATGRGASVVLFEKDDLASATSSASTKLIHGGLRYL
EHYEFRLVREALMERERLWRLAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRKL
LPATKTLDLAHDPAGRPLKDDHARAFEYSDCWVEDSRLVVLNAADAAARGAAVHTRTKVV
SADRDGDLWRIVGEGEAGRITVTAKALVNAAGPWVGEVLGGVVRSNTKAAVRMVQGSHIV
VPKLYEHDRCYIFQNADGRIIFAIPYEHDFTLIGTTDRDYQGDPAQAKATPEEIDYLCAA
ASEYFRAAVTPEQVVWTYSGVRPLYDDGASKAQEATRDYVLTLDAPKGEAPLLSVFGGKI
TTYRRLAEAALDKLAPHAGWAGRPAWTVYGTLPGGDFPVTGFEALVNEIAAAHPWLARST
VTRLVRAYGTKAHEILAGAQGMSDLGRHFGADLHERELRYLIRKEWAKRGADVLWRRGKL
GLRLSVEERDALDAFMLAEAKATTEPAV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgctgagccagcttacgatctcgcggtcatcggcggtggcatcaatggttgc
ggcatcgcccgcgacgccaccgggcgcggagcctcggtcgtgctgttcgagaaggacgac
ctcgccagcgccacctcctcggcctcgaccaaattgatccatggcgggctgcgctatctc
gagcactatgaatttcggctggtgcgcgaagccttgatggagcgcgagcggctctggcgg
ctcgcgccgcacatcatccggccgctgcgcttcgtgctgccgcaccatgccggcctgcgc
cccgcctggctgctccggctcgggcttttcctctacgaccatatcggcggacgaaagctc
ctgccggcgacgaagacactcgatcttgctcatgatcctgccggccggccgctcaaggac
gaccatgcgcgggctttcgaatattccgattgctgggtcgaggattcccgcctcgtcgtg
ctgaacgcggctgatgcagccgccaggggagccgcggtccacacacgaacaaaggtcgtc
tcggccgatcgcgacggcgacctctggcggatcgtcggggaaggcgaagccggccgcatc
actgtcaccgccaaggcgctggtcaacgccgccggcccctgggtcggcgaggttttgggc
ggcgtcgtgcgctcgaacaccaaggccgccgtccgcatggtccagggcagccatatcgtc
gtgcccaaactctacgagcacgaccgctgctacatcttccagaacgccgatggccgcatc
atcttcgcgatcccctatgagcacgacttcaccctgatcggcaccacggaccgcgactac
cagggcgatcctgcgcaagcgaaagcgacgcccgaggagatcgattatctctgcgccgcc
gcaagcgagtattttcgcgcagccgtcacgccggagcaggtcgtctggacctattccggc
gtgcgtccgctctatgacgacggcgcctccaaggcgcaggaagcgacgcgcgactatgtg
ctgacgctcgacgcgcccaagggcgaagccccgctgctctcggtcttcggcggcaagatc
acgacctatcgccgcctcgccgaagcagctctggacaagctcgcgccacatgccggctgg
gccggccggcccgcctggaccgtctacggcacattgcccggcggcgatttcccggtgacc
ggcttcgaggcgctggtcaacgagatcgccgccgcccatccctggctggctcgatcgacc
gtgacgcgattggtgcgcgcctatggcacgaaggcgcacgagattctcgccggcgcgcaa
ggcatgagcgatctcggccgccatttcggcgccgaccttcatgagcgcgagctgcgctat
ctgatccgcaaggaatgggcgaagcgcggcgcggacgtgctctggcggcgcggcaagctg
ggcttgcgcctctcagtggaggagcgcgacgccctggacgccttcatgctggctgaagcg
aaggcgacgaccgagccggccgtctga

DBGET integrated database retrieval system