KEGG   Bosea vaviloviae: BHK69_23715Help
Entry
BHK69_23715       CDS       T04483                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bvv  Bosea vaviloviae
Brite
Enzymes [BR:bvv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BHK69_23715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Plant_NMP1
Motif
Other DBs
NCBI-ProteinID: AOO83045
UniProt: A0A1D7U6N3
LinkDB All DBs
Position
complement(5154203..5154907)
Genome map
AA seq 234 aa AA seqDB search
MTDLSAFPISKRWPAQHPDRIQLYSLPTPNGVKVSIALEELELPYEPHLIDIGKNETWGP
EFLSLNPNGKIPAIIDPNGPGGKPFGLWESGAILVYLAEKTGKLIPSDAGLRYETLQWVF
FQMAGVGPMFGQLGFFHKFAGKEYEDKRPRDRYANESKRLLGVLETRLTGRDWIMGSEYS
IADIALLGWVRNLVGFYGAGELVDYASLKQVPLWLERGLARPAVQRGLDSPKRG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctctccgctttcccgatctccaagcgctggccggcccagcatcccgaccgt
atccagctctattcgctgccgacgcccaatggtgtgaaggtttcgatcgcgctggaggag
ctcgaactgccctacgagccgcatctgatcgatatcggcaagaacgagacctggggcccg
gagttcctctcgctgaaccccaatggcaagatcccggcgatcatcgatcccaatggcccc
ggcggaaagcctttcgggctgtgggaatcgggcgcgatcctggtctatctcgccgagaag
accggcaagctcatcccgagcgatgctggcctgcgctacgagaccctgcaatgggtcttc
ttccagatggcgggggtggggccgatgttcggccagctcggcttcttccacaaatttgca
ggcaaggagtatgaggacaagcgtccgcgcgaccgctacgccaatgaaagcaagcgcctg
ctcggcgtgctggagaccaggctcaccggccgcgactggatcatgggaagcgagtacagc
atcgccgacatcgccttgctcggctgggtgcgcaacctggtcggcttctatggtgctggc
gagctcgtcgactatgccagcctgaagcaggtgccgctctggctcgagcgcggcctggcg
cggccggcggtgcagcgcggcctggacagccccaagcgcgggtaa

DBGET integrated database retrieval system