KEGG   Bosea vaviloviae: BHK69_25185Help
Entry
BHK69_25185       CDS       T04483                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00473  D-Alanine metabolism
bvv00550  Peptidoglycan biosynthesis
bvv01100  Metabolic pathways
bvv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BHK69_25185
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BHK69_25185
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BHK69_25185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvv01011]
    BHK69_25185
Enzymes [BR:bvv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BHK69_25185
Peptidoglycan biosynthesis and degradation proteins [BR:bvv01011]
 Precursor biosynthesis
  Amino acid ligase
   BHK69_25185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AOO84765
UniProt: A0A1D7UBM0
LinkDB All DBs
Position
complement(5464505..5465419)
Genome map
AA seq 304 aa AA seqDB search
MTKHVAVLMGGWSVEREVSLSSGTACAKALESVGFRVTRIDVQRDIAQVLADLRPDVAFN
ALHGRFGEDGLIQGVLEILRIPYTHSGVLASALAIRKDKAKLVAAAAGVPVAHGIVVSRF
DAAKKHVLQPPYVLKPINEGSSVGVVIVKKGREHPPQEIAREDWPCGDTLLAEGFVRGRE
LTCAVMGGKSLGVTEIRASTGEFYDYDAKYTKGGSIHICPAQILPKIYQQIEECALTAHQ
AIGCRGVSRSDFRYDDETDTLVWLEVNTQPGMTETSLVPELAAHAGMNFGELVKWMVEDA
SLDR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacacgtcgcagtgctgatgggcggatggtccgttgagcgggaggtcagcctc
agcagcggcacggcctgcgccaaggcgctggagagcgtcggcttccgcgtcacgcgcatc
gacgtgcagcgcgacattgctcaggtgctcgccgacctgcgccccgatgtcgccttcaac
gcgctgcatggccgcttcggcgaggatggcctgattcagggcgtgctcgagattttgcgc
attccctacacgcattcgggcgtgctcgcctcggcgctcgcgattcgcaaggacaaggcg
aagctcgtcgcggcggcagccggcgtgccggtggcgcatggaatcgtggtttcacgcttc
gatgcggcaaaaaaacacgttctgcagccgccttacgtgctcaagccgatcaatgagggc
tcgtccgtcggcgtcgtgatcgtcaagaagggccgcgagcacccgccgcaggagatcgcc
cgcgaggactggccctgcggcgatacgctgttggctgaaggcttcgtcagggggcgcgag
ctgacctgcgccgtcatgggcggcaagtcgctgggcgtgaccgagatccgggcctcgacc
ggggagttctacgactacgatgcgaaatacacgaaaggtggttcgatccacatctgcccg
gctcaaattttaccaaaaatttaccagcagatcgaagagtgtgcgttaacggcgcatcaa
gcaatcgggtgccggggcgttagcaggtctgacttccgctatgacgacgagaccgacact
ctcgtctggctggaagtcaacacgcagcccggcatgaccgaaacgagcttggtgcccgaa
ttggccgcccatgcgggcatgaacttcggtgaactcgtcaaatggatggtggaggacgcc
tccctcgatcggtga

DBGET integrated database retrieval system