KEGG   Bosea vaviloviae: BHK69_27675Help
Entry
BHK69_27675       CDS       T04483                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00061  Fatty acid biosynthesis
bvv00780  Biotin metabolism
bvv01100  Metabolic pathways
bvv01130  Biosynthesis of antibiotics
bvv01212  Fatty acid metabolism
Module
bvv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BHK69_27675
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BHK69_27675
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BHK69_27675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bvv01004]
    BHK69_27675
Enzymes [BR:bvv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BHK69_27675
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BHK69_27675
Lipid biosynthesis proteins [BR:bvv01004]
 Fatty acid synthase
  Component type
   BHK69_27675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AOO83720
UniProt: A0A1D7U8K4
LinkDB All DBs
Position
complement(5982408..5983250)
Genome map
AA seq 280 aa AA seqDB search
MPDAITAALPTANLLKGKRGLVMGVANNRSIAWGIAKAAADAGAELAFTYQGDALKKRVE
PLAKELGGHVVGHCDVTDSASIDAVFAEIEKLWGKLDFVVHCIAFSDKDELTGRYVETSE
ANFTKSLLISCYSFTAVTQRAEKLMSDGGAMLTLTYYGAEKWMPHYNVMGVAKAALEASV
QYLAADLGPSKIRVNAISAGPIKTLAASGIGDFRYILRWNEYNSPLRRTVTIEEVGETAV
FLVSDMSRGITGEILHVDAGYHVVGMKVPTAPDISLERSE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgccatcaccgccgcccttccgaccgccaatctgctcaagggcaagcgcggc
ctcgtgatgggtgtcgccaacaaccgttcgatcgcctggggcattgccaaggccgccgcc
gacgccggcgcggaactcgccttcacctatcagggcgatgcgctgaagaagcgcgtcgag
cctctggcgaaagagctcggcggccatgtcgtcggccattgcgacgtcaccgattcggcc
tcgatcgatgccgtcttcgccgagatcgagaagctctggggcaagctcgatttcgtcgtc
cactgcatcgccttttccgacaaggacgaattgaccggccgctatgtcgagaccagcgag
gcgaacttcaccaagtcgctgctgatctcctgctactccttcaccgctgtgacacagcgc
gcggagaagctgatgagcgatggcggcgccatgctgacgctgacctattacggcgccgag
aagtggatgccgcattataacgtcatgggcgtcgccaaggccgcgctcgaggcgagcgtg
caatatctcgccgccgatctcggcccctcgaagatccgcgtcaacgcgatctcggctgga
ccgatcaagacgctggcggcgtcgggcatcggcgatttccgctacatcctgcgctggaac
gaatataactcgccgctgcgccgcaccgtgacgatcgaggaggtcggcgagaccgccgtc
ttcctggtctccgacatgtcgcgcggcatcaccggcgagatcctgcatgtcgatgcgggc
tatcacgtcgtcggcatgaaggtgccgaccgcgcctgatatctcgctcgaacgcagcgag
tga

DBGET integrated database retrieval system