KEGG   Bosea vaviloviae: BHK69_27870Help
Entry
BHK69_27870       CDS       T04483                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bvv  Bosea vaviloviae
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BHK69_27870
Enzymes [BR:bvv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     BHK69_27870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AOO83751
UniProt: A0A1D7U8N1
LinkDB All DBs
Position
6017944..6018984
Genome map
AA seq 346 aa AA seqDB search
MRAVVIHAEKDLRVEETTAPELGPLDVRVRIEAGGICGSDLHYYLHGGFGTIRIKEPMIL
GHEIAGTVQAVGGEVSRVKPGDRVAVNPSRACGRCRYCQMGQQQHCTDMLFYGSAMRFPH
VQGGFRDILVVEERQAVKVAAGVSAAMAAFAEPLSVCLHAAKRAGPLLGKRVLVTGSGPI
GVLAVVAAKAAGASEIVATDVVDGPLPTALKMGATAAINVMAEPERLKAEYGAEKGSFDV
MFEASGNQHALTGAFDVVRSGGTIVQIGVGGNFTLPMNVLVAKEFDLRGSFRFHEEFDWA
VAMIGSGSIDLSPLLTASIPVERAIEAFDLAADKSKAMKVQLAFAS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtcatccatgccgaaaaggatctgcgcgtcgaggagacgaccgcccct
gagctcgggccgctcgatgtccgcgtgcgcatcgaggccggcggcatctgcggctccgac
ctgcattattacctgcatggcggcttcggcacgatccgcatcaaggagccgatgatcctc
ggccatgagatcgccggcacggtccaggccgtgggcggcgaggtttcgcgcgtcaagccc
ggcgaccgcgtcgcggtcaatcccagccgcgcctgcgggcgctgccgctattgccagatg
ggccagcagcaacactgcaccgacatgctgttctacggctcggcgatgcgctttccccat
gtccagggcggtttccgcgatattctcgtcgtcgaggagcgccaggcggtaaaggtcgca
gccggcgtcagcgcggcaatggccgccttcgccgagccgctttcggtctgcctgcatgcc
gccaagcgcgccggcccgctgctcggcaagcgcgtgctggtgacgggctcaggcccgatc
ggcgtcctggcggtggtggcggccaaggcagctggagcctccgagatcgtcgcgaccgat
gtggtcgatggccccttgccgacagcgctgaagatgggtgcgaccgccgcgatcaacgtc
atggccgagccggaacggttgaaggcggaatacggtgctgagaagggctccttcgacgtg
atgttcgaggcctcaggcaatcagcacgcgctgacgggcgccttcgatgtggtgcgctcg
ggcggtaccatcgtgcagatcggcgtcggcggcaatttcaccctgccgatgaatgtgctc
gtcgccaaggagttcgacctgcgcggctccttccgcttccatgaggagttcgactgggca
gtggcgatgatcggctcaggcagcatcgacctctcgccgctgctgacggcatcgatcccg
gtcgagcgcgcgatcgaggctttcgatctcgccgccgacaagtcgaaggcgatgaaggtg
cagctggctttcgcgtcgtag

DBGET integrated database retrieval system