KEGG   Bacillus wiedmannii: CT694_06625Help
Entry
CT694_06625       CDS       T05831                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00061  Fatty acid biosynthesis
bwd00780  Biotin metabolism
bwd01100  Metabolic pathways
bwd01130  Biosynthesis of antibiotics
bwd01212  Fatty acid metabolism
Module
bwd_M00083  Fatty acid biosynthesis, elongation
bwd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CT694_06625
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CT694_06625
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CT694_06625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bwd01004]
    CT694_06625
Enzymes [BR:bwd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CT694_06625
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CT694_06625
Lipid biosynthesis proteins [BR:bwd01004]
 Fatty acid synthase
  Component type
   CT694_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AZJ19385
UniProt: A0A3S5HGY7
LinkDB All DBs
Position
1226529..1227299
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTPEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgttgttatgggcgttgcgaaccaaagaagtatt
gcgtggggaattgctcgctctttgcataatgcaggtgcaaaattaatattcacatatgca
ggagaacgtttagaaagaaacgttcgtgaattagcggacacattagaaggacaagaatca
cttgtattaccttgtgatgtaacaaatgatgaagaacttacagcttgctttgaaacaatc
aagcaagaggttggtacaattcacggtgttgcacactgtattgcttttgcaaatcgtgat
gatttaaaaggtgaatttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agtgcattctctttaacagctgtagcaagagaagcgaagaaagtaatgacagaaggcgga
aatattttaacgctaacataccttggcggcgagcgcgttgtgaaaaactataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtaaaatatttagctaacgatttaggccaa
cacggcattcgcgttaacgctatttctgcaggaccaattcgtacgttatctgcaaaaggc
gtaggcgactttaactcaattttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaactccagaagaagttggggatacagcagtattcttattcagtgatttagcacgcggc
gtaacaggagaaaacattcacgttgattcagggtatcatatcctaggataa

DBGET integrated database retrieval system