KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0103Help
Entry
BcerKBAB4_0103    CDS       T00642                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bwe  Bacillus mycoides KBAB4
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bwe03012]
    BcerKBAB4_0103
   03029 Mitochondrial biogenesis [BR:bwe03029]
    BcerKBAB4_0103
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bwe04147]
    BcerKBAB4_0103
Translation factors [BR:bwe03012]
 Eukaryotic Type
  Elongation factors
   BcerKBAB4_0103
 Prokaryotic Type
   BcerKBAB4_0103
Mitochondrial biogenesis [BR:bwe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BcerKBAB4_0103
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BcerKBAB4_0103
  Exosomal proteins of breast cancer cells
   BcerKBAB4_0103
  Exosomal proteins of colorectal cancer cells
   BcerKBAB4_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW CbiA
Motif
Other DBs
NCBI-ProteinID: ABY41372
UniProt: A9VP75
LinkDB All DBs
Position
124943..126133
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEARGYDQIDAAPEERERG
ITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGFPGDDIPVIKGSALKALQ
GEAEWEEKIIELMTEVDAYIPTPERETDKPFLMPIEDVFSITGRGTVATGRVERGIVKVG
DVVEIIGLAEENATTTVTGVEMFRKLLDQAQAGDNIGALLRGVAREDIQRGQVLAKTGSV
KAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVTGIIQLPEGTEMVMPGDNIEM
TIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVAE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctaaattcgaacgttctaaaccccatgttaacatcggtacaatcggccac
gttgaccatggtaaaactacattaactgctgcgatcactacagttcttgcaaaagctggt
ggtgctgaagcacgcggatacgatcaaatcgacgctgctccagaagaaagagagcgcgga
atcacaatctcaactgcacacgttgagtacgaaactgaaactcgtcactatgcacacgtt
gactgcccaggtcatgctgactatgttaaaaacatgatcactggtgctgctcaaatggac
ggcggtatcttagtagtatctgctgctgatggtccgatgcctcaaacacgtgagcacatc
cttctttctcgtcaagtaggtgttccttacatcgttgtattcttaaacaaatgcgacatg
gtagatgacgaagaattattagaattagtagaaatggaagttcgcgacctattatctgaa
tacggattcccaggcgacgatattcctgtaattaaaggttctgctcttaaagctcttcaa
ggagaagctgagtgggaagaaaaaatcatcgaattaatgactgaagttgatgcttacatc
ccaactccagaacgtgaaactgacaaaccattcttaatgcctatcgaggatgtattctct
atcacaggtcgtggtacagttgcaactggtcgtgttgagcgtggaatcgttaaagttggt
gacgtagtagaaatcatcggtcttgctgaagagaatgctactacaactgtaactggtgta
gaaatgttccgtaagcttcttgaccaagctcaagctggagacaacatcggtgctctactt
cgtggggttgctcgtgaagacatccaacgtggacaagttcttgctaaaactggctctgta
aaagcacacgctaaattcaaagctgaggttttcgtattatctaaagaagaaggtggacgt
catactccattcttcgctaactaccgtccacagttctacttccgtacaactgacgtaact
ggtatcatccaattaccagaaggtactgaaatggtaatgcctggtgacaacatcgaaatg
actatcgaacttatcgctccaatcgctatcgaagagggaactaaattctctattcgtgaa
ggtggacgtacagtaggttacggtgtagttgctacaatcgttgctgagtag

DBGET integrated database retrieval system