KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0324Help
Entry
BcerKBAB4_0324    CDS       T00642                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bwe  Bacillus mycoides KBAB4
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BcerKBAB4_0324
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BcerKBAB4_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 DAO AlaDh_PNT_C K_oxygenase NAD_binding_8 Glutaredoxin Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABY41590
UniProt: A9VRK0
LinkDB All DBs
Position
complement(373345..374871)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLSLVDELATMSSKITVEKVELER
TPSFSVNRPGEETGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVYLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYNIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFIGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFGAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcagttaatggagaac
gatattttacttaaagtaagcgcaggagacgataacgtatctaaagatatgttatctcta
gtagatgaattagctactatgtcatctaagattacagtagaaaaagttgaactagagaga
acaccaagctttagcgtaaatcgccctggtgaagaaactggtgtcgtattcgctggtatt
ccattaggacacgaatttacttcattagtgttagctttactacaagttagtggacgtgct
ccaaaagttgaacaaaaattaatcgatcaaatcaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttctaaactctggtattacacatactatgattgatggcgctgcatttaaagag
gaagtagaaagtaaagacatcatggcagtaccaactgtttacctaaatggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggcccagctggt
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggtattgagaacttcatcagcgtaaaacgcact
gaaggtcctaagctagtagcaagtcttgaagagcacgtaaaagaatacaacatcgatgta
atgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttcaacaggtgctcgctggcgtaat
gttggtgtaccgggtgaagctgagttcaaaaacaaaggtgtagcatactgcccacactgt
gacggtccattattcatcggaaaagatgtagcggttatcggcggtggtaactctggtatt
gaagcagctattgacttagcaggtattgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagaacgtcttaacagcttacctaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaattactggtactgacaaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagtacaccatgttgaattacaaggtgtattcgttcaaatc
ggtcttgtgccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttggtgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcgaatgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system