KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1931Help
Entry
BcerKBAB4_1931    CDS       T00642                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00473  D-Alanine metabolism
bwe01100  Metabolic pathways
bwe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BcerKBAB4_1931
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BcerKBAB4_1931
Enzymes [BR:bwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BcerKBAB4_1931
Peptidoglycan biosynthesis and degradation proteins [BR:bwe01011]
 Precursor biosynthesis
  Racemase
   BcerKBAB4_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker
Motif
Other DBs
NCBI-ProteinID: ABY43162
UniProt: A9VRX7
LinkDB All DBs
Position
1991278..1992504
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNVIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKSAIEAGINQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDV
MMTVYRVEDLQGIDEVANHLQKKVRIHVKIDTGMSRIGLQEEEVKPFFEELKRMRYVEVV
GMFTHYSTADEIDKTYTNMQTSLFEKAVNTAEELGIHFPYIHSSNSAGSMELSNTFQNMV
RVGIGIYGMYPSREVDHTVASLQPALSLKSKVAHVKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVTNAMPVQVGDEVVFYGKQD
EEEIAVEEIADMLGTINYEVTCMLDRRIPRVYKENDETTAIVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgtaattattgagttaggagttagaccaatgagcttg
aaatatggaagagatacaattgttgaagttgacttaaatgcggtaaaacataatgtaaaa
gaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggtcatggggcagttgaagttgcgaaatcggctattgaagcaggaataaaccaa
cttgcagttgcatttgtagatgaagcaattgaattaagagaagctggaatcactgtacct
attttaattttaggatatacaccagtagcagctgtagaagatgtaattcaatatgacgtt
atgatgactgtttatagagtagaagatttacaaggtatagatgaagttgcaaaccatctt
caaaagaaagtgcgaattcatgtgaaaattgatacaggaatgagccgtattggtttacag
gaagaagaagttaaaccgttttttgaagagttaaaacgtatgcgatatgtagaagtagta
gggatgtttacacattactctaccgctgatgaaatagataaaacttatacaaatatgcaa
acaagtttgtttgagaaagctgtaaatacagcggaagaattaggaattcattttccatat
attcatagttcaaacagtgcaggatcaatggaacttagtaacacatttcaaaatatggtt
cgtgtcggtattggaatttacggtatgtatccttcaagagaagtggatcatacagttgct
tccttacagccagcgttgtctttaaaatcaaaagtagctcatgttaaacatgcgaagaaa
aatcgtggtgttagctatgggaatacttatgtaacaacgggcgaagaatggattgcaact
gtaccgattggttatgctgatggttataatcgtcagctatctaataaagggcatgcgcta
ataaacggagtacgagtacctgtaattggccgtgtttgtatggatcagcttatgctagat
gttacaaatgcaatgccagtacaagtaggagacgaagttgtattctacggcaaacaagat
gaagaagagattgcggtagaagaaatagcagatatgctaggtacaattaactatgaagtt
acatgtatgttggacagaagaattccacgtgtctataaagaaaatgatgaaacgactgca
attgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system