KEGG   Bacillus mycoides KBAB4: BcerKBAB4_2634Help
Entry
BcerKBAB4_2634    CDS       T00642                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00053  Ascorbate and aldarate metabolism
bwe00071  Fatty acid degradation
bwe00280  Valine, leucine and isoleucine degradation
bwe00310  Lysine degradation
bwe00330  Arginine and proline metabolism
bwe00340  Histidine metabolism
bwe00380  Tryptophan metabolism
bwe00410  beta-Alanine metabolism
bwe00561  Glycerolipid metabolism
bwe00620  Pyruvate metabolism
bwe00625  Chloroalkane and chloroalkene degradation
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
Module
bwe_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_2634
   00053 Ascorbate and aldarate metabolism
    BcerKBAB4_2634
   00620 Pyruvate metabolism
    BcerKBAB4_2634
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BcerKBAB4_2634
   00561 Glycerolipid metabolism
    BcerKBAB4_2634
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BcerKBAB4_2634
   00310 Lysine degradation
    BcerKBAB4_2634
   00330 Arginine and proline metabolism
    BcerKBAB4_2634
   00340 Histidine metabolism
    BcerKBAB4_2634
   00380 Tryptophan metabolism
    BcerKBAB4_2634
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BcerKBAB4_2634
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BcerKBAB4_2634
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BcerKBAB4_2634
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BcerKBAB4_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABY43836
UniProt: A9VIH6
LinkDB All DBs
Position
complement(2692987..2694471)
Genome map
AA seq 494 aa AA seqDB search
MLTTNIELKPKVKAFLNEEIKMFINGEFVSSISGKTFETYNPATEDVLAVVCEAQEEDID
VAVKAARFAFESGPWAEMTTAERAHLIYKLADLIEEHREELAQLEALDNGKPYQVALDDD
ISATVENYRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGA
ALATGCTIVLKPAEQTPLSLLYTAKLFKEAGFPNGVVNFVPGFGPEAGSAIVNHHDIDKV
AFTGSTVTGKYIMRQSAETIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNC
SAGSRVFVHRKHYETVVNELVKMANDVKLGAGMEAETEMGPLVSKKQQERVLNYIEQGKS
EGATVAAGGKRAFEKGYFVQPTVFTNVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANR
SSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGYKQSGIGRELGSYAL
DNYTEVKSVWVNIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgacaaacattgagctgaaaccaaaagtgaaagcgtttttaaatgaagaaatt
aaaatgttcattaatggtgaatttgtttcttcaataagtgggaagacatttgaaacatac
aatccagcgacagaagatgttctagcagtcgtatgtgaagcgcaagaagaagatattgat
gtcgcagtaaaagcggcaagatttgcttttgaatcaggcccgtgggcagagatgactact
gctgaaagagcacaccttatttataaattagcagatttaattgaagagcatagagaagaa
ttagcacagctggaagctttagataatggaaaaccatatcaagtagcacttgatgatgat
atttcagcgactgtagaaaattaccgctattacgcgggatgggctacaaaaattattggg
caaaccattccaatttcaaaagattatttaaattacacacgccatgaaccggttggcgtt
gtaggtcaaattatcccgtggaattttccgctcgttatgtcttcttggaaaatgggagcc
gctcttgcgacgggttgtacgattgtattaaaaccagcagagcaaacacctttatcttta
ctatatacagcgaagctttttaaagaagctggttttccaaacggtgtcgtaaactttgta
ccaggtttcggtcctgaagcaggatcggcaattgtaaaccatcatgatattgataaagta
gctttcacaggttcaacagttacagggaaatatattatgcgtcaatctgcagaaacaatt
aaacatgtaacgttagaacttggtggtaagtcaccaaacatcattttagaagacgctgac
ttagaagaagcgattaacggtgcgttccaaggcattatgtataatcatggtcaaaattgt
agcgcaggatctcgcgtgtttgtccaccgaaaacattatgaaacagtcgtaaatgaactt
gtaaaaatggcgaatgacgtgaagctaggggcaggtatggaggcggaaactgaaatggga
ccgctcgtatctaaaaaacaacaagagcgtgtgctaaattacattgaacaaggaaaatct
gaaggtgctactgttgcagctggtggtaaacgtgcatttgaaaaaggttattttgtacag
ccaacagtattcacaaatgttacagacgatatgacaatcgttaaggaagaaattttcgga
ccagttgtcgttgtactcccgttcgattcgacagaagaagtaattgaaagagcaaatcgc
tcgtcttacgggcttgctgcgggcgtatggacacaaaatattaaaaccggacatcaagtt
gccaataaattaaaggcaggaacagtgtggattaatgattataacttagaaaatgcagct
gcaccatttggtggatataagcaatctggtatcggacgtgaattaggttcatacgccctt
gataactatacagaagtgaaaagtgtttgggtaaatataaagtaa

DBGET integrated database retrieval system