KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3200Help
Entry
BcerKBAB4_3200    CDS       T00642                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00500  Starch and sucrose metabolism
bwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BcerKBAB4_3200
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BcerKBAB4_3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ABY44376
UniProt: A9VMV3
LinkDB All DBs
Position
complement(3245625..3247166)
Genome map
AA seq 513 aa AA seqDB search
MLKRITVVCLLFTLLFPNIYEGNKAEAATVNNGTLMQYFEWYAPNDGNHWNRLRSDAESL
AHKGITSVWIPPAYKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNIEVSGDYQISAWTGFNFPGRGDAYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGVDKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHARQQTGKEMFTVAEYWQNDVQAL
NNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILNGTVMKNHPALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKGKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDGVHANSGLATLLSDGPGGSKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFYVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaggattacggtagtctgtttattgtttactttactttttcctaatatatat
gagggaaataaggcggaagcagcaacagtgaacaatggaacattaatgcagtattttgag
tggtacgctccgaatgatgggaatcattggaatcgtttgcgctccgatgctgaaagttta
gctcataaaggaatcacatctgtatggataccacctgcatataaggggacttcgcaaaat
gatgtagggtatggggcctatgatttatatgatttaggggagttcaatcaaaaaggaacg
gtgcggacgaaatatgggacgaaagcacagttgaaatctgcaattgacgcattacataag
caaaacatcgacgtatacggtgatgtagttatgaatcataaaggtggggctgattatact
gaaaccgtaacagctgttgaggtagaccgtaacaatcgaaatattgaagtatcaggtgat
tatcaaattagtgcatggacggggtttaattttccaggtcgcggagatgcttattctaat
ttcaaatggaaatggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtgtagataaagcgtgggattgggaagtgtctagcgaaaat
ggaaattatgattatttgatgtatgcagatcttgattttgatcatcctgatgttgcgaat
gagatgaaaaattggggaacatggtatgcgaatgaattaaatttagatggctttcgtttg
gacgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgccagacag
caaacggggaaagaaatgtttacagtagctgaatattggcaaaatgatgttcaggcttta
aacaattatttagcgaaagtcaattataatcaatctgtgtttgatgcaccgcttcattac
aattttcattatgcttcaacaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgaaaaatcaccctgcactcgcagttactctcgttgagaatcatgattctcag
cctgggcagtcattggaatctgtagtaagtccgtggtttaagccgctggcatatgcattt
attttaactcgtgcagagggctatccttcagttttctatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaaggtaaaattgatccaattttgacggca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattggc
tggacaagagaaggcgatggtgtacatgctaattctggtttagcgacattactctcggac
ggaccaggaggatcaaagtggatggatgttggaaagaataacgctggggaagtatggtac
gatattacgggtaatcaaacaaatactgtaacaattaataaggacggatgggggcagttc
tatgtaagtggaggctcagtttccatatatgttcagcagtaa

DBGET integrated database retrieval system