KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3685Help
Entry
BcerKBAB4_3685    CDS       T00642                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bwe  Bacillus mycoides KBAB4
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bwe01001]
    BcerKBAB4_3685
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BcerKBAB4_3685
Protein kinases [BR:bwe01001]
 Serine/threonine kinases: Other
  Bacterial family
   BcerKBAB4_3685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Haspin_kinase Fructosamin_kin Kdo
Motif
Other DBs
NCBI-ProteinID: ABY44856
UniProt: A9VTA0
LinkDB All DBs
Position
complement(3736319..3738292)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDDIYYLVMEYVPGRTLKQYIIDRGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRDDGVVKVTDFGIATATSAATITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQNEMPSPKRWNDNIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFQNVSDETIVLKGSKVDEQVRKEETKSGKKKKRNNKWLKVLITTFLLLAIGITLALTVI
PGFFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNLVYTDDVEAGKVIKTDPIAGRVV
KENSKITIYQSGGKKKSKMRDLTGKDFESIRAELEEEYKQVTINYIENDKPKGEIVEQIP
TPDQMVIETEQELKIWVSKGPYQIRPGDFSGWTENSVKGYLNERKLVSDIQREYSDKVDK
GLVISQLPKPGTPLKEGDKVSIVISDGPKPKVTKTVKVDNISIPYEASATGEKKPQTIEI
YKEDMQQKMDKPVETRTITESAIISLEFVIQEGAKGHYKIVRDGVTIMDKEVPYPAQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggcggtgga
ggaatggccaatgtatatttagctcatgatgatatactcggccgagatgtagcggtaaaa
atattaagactcgactactcaaataatgaagagtttattaaacgtttccatcgagaagcg
caatctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgttggggaagag
gatgatatatattatcttgtaatggaatatgtacctggacgaacattgaagcaatacata
attgatcgagggatgttaccgataggagaggctcttgatataatggagcagttaacgtcc
gctatggcacacgcccatcattttgagattgtacatcgtgatattaaaccgcacaatatt
ttgattcgagatgacggagtggtcaaagtaacagactttggaattgcgacagctacaagt
gcagcaacaattacacatacaaattcggtgctcggttcggtgcattatttatcaccagaa
caagcgcgcggcggtatagcgaataaacaatcagatatttattcacttgggattgttatg
tttgaattgttaacaggaagacaaccgttttctggtgaatctgctgttgcaattgcgtta
aaacatttacaaaatgaaatgccatctccaaaaagatggaatgacaatattccacaaagt
gttgaaaatattatattaaaggcaactgcgaaagatccgttccatcgatatcaatctgct
aacgcgatgaaacgagatattgaaacagcactatacccagaacgaataaatgaacaacca
ttttacataccagaagatatggaagcaacgaaagcgattccaattattcaacaagaacaa
ctatttcaaaatgtaagtgatgaaacgattgtattaaaaggaagtaaagtggatgaacaa
gtaagaaaagaagagaccaaatcaggtaagaagaaaaagcgaaataataaatggctgaaa
gttttaattacaacatttttacttttagcgatagggataacattagcacttactgttatt
ccaggcttctttattccgaaagatgtgaaggttcctgatgtggctggtatgaaatatacg
acagctgtaaatacattagttgaaaaaggttttgaagttactgaacctaatcttgtatat
acagatgatgttgaagccggaaaagtgataaaaacagatcctatagcaggaagagtagtg
aaagaaaactctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatgcgt
gatttgacaggaaaagatttcgagagtataagagctgagttagaagaagaatataaacaa
gttacaataaattatattgaaaatgataagccgaaaggtgaaattgtagagcaaatacca
acgcctgatcaaatggttatagagacagaacaagaactgaaaatttgggtaagtaaagga
ccttatcaaataagaccaggtgatttttcaggatggactgaaaatagtgtaaaaggttat
ttaaatgaaagaaagcttgtttctgatatacaaagagagtattcagataaggttgataaa
ggtcttgttatttcacagttaccaaagcctgggacacctttaaaagaaggagataaagta
tcgattgttatctccgatggtccgaagcctaaagtgacgaaaacggtaaaagtggataac
atttctatcccatatgaagcttctgcaacaggtgagaaaaagccgcaaacaatagaaatt
tataaagaagatatgcagcaaaaaatggataaaccagttgaaacgagaacaattactgag
tcagcgattatttctttagaatttgtaattcaagaaggtgcaaagggacactataaaatt
gtccgagatggagtaacgattatggacaaggaagtaccatatccagctcaataa

DBGET integrated database retrieval system