KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4128Help
Entry
BcerKBAB4_4128    CDS       T00642                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Brite
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BcerKBAB4_4128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABY45290
UniProt: A9VH58
LinkDB All DBs
Position
complement(4132196..4132807)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKAEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNVAEKLYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagaacctcacttt
gataaagaaacaatgaacatccatcatacaaaacatcacaacacgtatattacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgttgaagaattagttgca
aacttaaacgaagtacctgaagcaatccgtacagcagtacgtaacaatggtggcggacat
gctaaccatacattcttctggacaatcctatctccaaacggcgggggacaaccagtaggc
gaacttgcaactgcgattgaagcgaaattcggtagcttcgatgcattcaaagcagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaataatggt
gagttagaagtaacaagcactccaaaccaagattctcctctaactgaaggtaaaactcca
gttatcggtttagatgtttgggagcatgcttactacttaaattaccaaaaccgtcgtcct
gactacatcggtgcattctggaacgttgtagattggaacgttgctgaaaaactttaccaa
gaagcaaaataa

DBGET integrated database retrieval system