KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4954Help
Entry
BcerKBAB4_4954    CDS       T00642                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 1
  KO
K06019  pyrophosphatase PpaX [EC:3.6.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BcerKBAB4_4954
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     BcerKBAB4_4954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_3 NIF Arabinose_Isome Peptidase_C47 DUF1896 Serine_rich
Motif
Other DBs
NCBI-ProteinID: ABY46102
UniProt: A9VQ75
LinkDB All DBs
Position
complement(4914984..4915631)
Genome map
AA seq 215 aa AA seqDB search
MKINTVLFDLDGTLINTNELIISSFLHTLNHYYSNQYKREDVLPFIGPSLHDTFSKIDAS
KVEEMITCYRQFNHEHHDELVEEYETVYETVQELKKQGYKIGIVTTKARQTVEMGLKLSK
LDQFFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEETLMVGDNHHDIVGGQNAGTKTVA
VSWTLKGRAYLEAYKPDYVLDKMSDLLPILSRING
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagtgttatttgatttagatggaacgttaattaatacaaatgaactt
attatctcttcttttttacatacgttaaatcactattattctaatcagtataagcgtgaa
gatgtattgccatttatcggtccatctttgcatgatacttttagtaagattgatgcaagt
aaggttgaagagatgattacatgttatcgtcaatttaatcatgagcatcatgatgaatta
gtggaagagtatgaaactgtatatgaaacggttcaagaattgaagaagcaaggttataag
atcggcatcgttacaacgaaagcgagacagacggttgaaatgggattaaagctttcgaaa
cttgatcagttttttgatgttgtcgtgacgattgatgatgtggaacatgtgaaaccacat
ccagaaccacttcaaaaagcactcgaattattagatgcaaagccagaagaaacattgatg
gttggtgataatcatcatgatatcgtcggtggacaaaatgcaggtacgaaaacagtagcg
gtttcatggacattgaaaggtagagcgtatttagaagcgtataaaccagattatgtgcta
gataaaatgagtgatttactaccgattttgtcccgtattaacgggtag

DBGET integrated database retrieval system