KEGG   Bacillus weihaiensis: A9C19_04745Help
Entry
A9C19_04745       CDS       T04822                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00010  Glycolysis / Gluconeogenesis
bwh00030  Pentose phosphate pathway
bwh00051  Fructose and mannose metabolism
bwh00052  Galactose metabolism
bwh00680  Methane metabolism
bwh01100  Metabolic pathways
bwh01110  Biosynthesis of secondary metabolites
bwh01120  Microbial metabolism in diverse environments
bwh01130  Biosynthesis of antibiotics
bwh01200  Carbon metabolism
bwh01230  Biosynthesis of amino acids
bwh03018  RNA degradation
Module
bwh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9C19_04745
   00030 Pentose phosphate pathway
    A9C19_04745
   00051 Fructose and mannose metabolism
    A9C19_04745
   00052 Galactose metabolism
    A9C19_04745
  09102 Energy metabolism
   00680 Methane metabolism
    A9C19_04745
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    A9C19_04745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bwh01009]
    A9C19_04745
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bwh03019]
    A9C19_04745
Enzymes [BR:bwh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A9C19_04745
Protein phosphatases and associated proteins [BR:bwh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A9C19_04745
Messenger RNA biogenesis [BR:bwh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A9C19_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: APH04103
UniProt: A0A1L3MP20
LinkDB All DBs
Position
1025275..1026234
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDSPGMNAAVRAVVRKAIFHNVEIYGIFHGYSGLIEGQIEKLELGSVGDI
IHRGGTKLYSARCPEFKTVEGQKKGIEQLKKHGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYNMDHVISRLQRGHERGKKHSIIVVAEGVGSGVEIAKQVEEATSF
ETRVSVLGHVQRGGSPSAFDRVLASRLGAFAVELLLEGKGGRCVGIQKNELVHHDILEIL
DQPHTIDENMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaattggtgtcctaactagtggaggagattcccctggtatgaacgcagctgta
cgtgctgtagtacgtaaggctatttttcataatgtagaaatttatggtatttttcatggg
tattctggattaattgaaggacaaatagaaaaattagaattaggctctgtaggagatatt
atccatcgtggtggtacgaagttatattctgcaagatgtcctgaattcaaaactgtagaa
ggtcagaaaaaagggatcgaacagttgaagaagcatggtattgaaggtctagttgtaatc
ggtggagacggctcgtatatgggagctaagaaattaactgagcatggattcccatgtgtt
ggtgttccgggtacgattgacaatgatattcctggtactgatttcacaatcggtttcgat
acagctttaaatactgttatcgacgctattgataaaattcgtgatacagctacttcacat
gaacgtacatatgtaattgaagtaatgggaagacatgctggtgatattgctctttggtca
ggacttgcaggtggagcagaaaccatcctaattccagaagcagactataacatggatcat
gtcatttctcgtcttcaacgtggacatgaaagagggaaaaagcatagtatcatcgttgtg
gctgaaggagtaggtagtggtgtggaaatcgccaaacaagtagaagaagctacttcattt
gaaactcgagtttcagttctaggtcatgttcagcgtggtggatctccatcagcatttgac
cgagtgttagcaagtagactaggtgcttttgcagtggagctacttcttgaaggaaaaggt
ggacgttgcgttggtattcaaaagaatgaacttgttcaccacgatattcttgagatttta
gaccaaccacatactattgacgaaaacatgtatcaattatctaaagaactttctatataa

DBGET integrated database retrieval system