KEGG   Bacillus weihaiensis: A9C19_05650Help
Entry
A9C19_05650       CDS       T04822                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
bwh  Bacillus weihaiensis
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bwh03016]
    A9C19_05650
Enzymes [BR:bwh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     A9C19_05650
Transfer RNA biogenesis [BR:bwh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    A9C19_05650
 Prokaryotic Type
    A9C19_05650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase GvpD tRNA-Thr_ED DUF432
Motif
Other DBs
NCBI-ProteinID: APH04266
UniProt: A0A1L3MPJ4
LinkDB All DBs
Position
1228880..1229317
Genome map
AA seq 145 aa AA seqDB search
MKVVVQRARNAQVVVENEVVGSIHEGVMVLVGVTHEDTEKDAEYLADKVVNLRIFEDESG
KMNHSLLDIGGQVLSVSQFTLYGDCRKGRRPNYMNAAKPDFASTIYEKFNDCLKEKGVQV
ETGTFGAMMDVQFTNVGPVTLLIES
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtagttgttcaaagagcacgaaatgcacaagtagtagtagaaaatgaggtagtt
ggttcgattcatgagggtgtcatggtactagtaggtgtaactcatgaggatacagaaaag
gatgctgaatatttagctgataaggtagttaatctgaggatatttgaagatgagagtgga
aagatgaaccactcattacttgatatcggtggccaagttctttctgtatcacaatttact
ctttatggtgattgtagaaaagggagacgacccaactatatgaatgctgcgaagcctgac
tttgcaagtacaatttacgaaaagtttaacgattgccttaaagaaaagggagtacaagta
gaaacaggtacattcggggcaatgatggatgttcagttcacaaatgtcggtccagttacg
ttactgatagaaagctga

DBGET integrated database retrieval system