KEGG   Bacillus weihaiensis: A9C19_14740Help
Entry
A9C19_14740       CDS       T04822                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00061  Fatty acid biosynthesis
bwh00780  Biotin metabolism
bwh01100  Metabolic pathways
bwh01130  Biosynthesis of antibiotics
bwh01212  Fatty acid metabolism
Module
bwh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9C19_14740
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A9C19_14740
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A9C19_14740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bwh01004]
    A9C19_14740
Enzymes [BR:bwh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A9C19_14740
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A9C19_14740
Lipid biosynthesis proteins [BR:bwh01004]
 Fatty acid synthase
  Component type
   A9C19_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DpaA_N
Motif
Other DBs
NCBI-ProteinID: APH05892
UniProt: A0A1L3MU83
LinkDB All DBs
Position
complement(3093345..3094118)
Genome map
AA seq 257 aa AA seqDB search
MNLSLNGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVRDLAESLERND
SIVLPCDVTNDEEIKTCFAQIKEEVGVVHGIAHCIAFAHKEELQGEYLNTTREGFLLSHN
ISSYSLTAVAKEARGLMTEGGSIVTLTYLGGERVLPNYNVMGVAKASLDASVRYLASDLG
KDGIRVNSISAGPIRTLSAKGISDFNSILKEIEERAPLRRTTTPEEVGDTALFLFSNLSR
GMTGENLHVDSGYHILA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatctctaaatggccgtaacatcgtcgtaatgggtgtagcgaataaacgtagt
attgcatggggaattgcacgctctttacatgaagcaggcgcacgtttaatctttacatat
gcaggtgaaaggcttgaaaagtcggtacgagatttagctgaatcacttgaacgcaatgat
tcaattgtcttaccttgtgatgtaacgaatgatgaggaaatcaaaacatgctttgcacaa
attaaagaagaagtgggcgttgttcatgggattgcccactgtattgcattcgctcacaag
gaagaattacaaggggaatacttaaatacaacacgtgaaggttttctactctctcataac
attagctcctattctttaactgctgtagctaaagaagcaagaggattaatgactgagggt
ggaagcatcgttacgttaacatatcttggtggagaacgtgtgctaccaaattataatgta
atgggagttgctaaagcctctctagatgcaagtgttcgatatttagcaagtgatttagga
aaagacggcattcgtgtcaactctatctctgctggtcctattcgtacattatcagcaaaa
ggtatcagtgattttaactctatcttaaaagaaattgaagaacgtgctccattaagaaga
acaacgactcctgaggaagttggagatactgctctattcttattcagtaatttatctaga
ggaatgacaggtgaaaatctgcacgttgattctggttatcatattttagcgtaa

DBGET integrated database retrieval system