KEGG   Bacillus weihaiensis: A9C19_17965Help
Entry
A9C19_17965       CDS       T04822                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00970  Aminoacyl-tRNA biosynthesis
bwh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A9C19_17965 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bwh03029]
    A9C19_17965 (gatA)
Enzymes [BR:bwh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A9C19_17965 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A9C19_17965 (gatA)
Mitochondrial biogenesis [BR:bwh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A9C19_17965 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase KIP1
Motif
Other DBs
NCBI-ProteinID: APH06466
UniProt: A0A1L3MVU2
LinkDB All DBs
Position
complement(3801607..3803064)
Genome map
AA seq 485 aa AA seqDB search
MELFDRKISELKELLHKKEITVSDLVDTSYKRIQEVDDKVGAFLTLNEEDARTYAKELDE
ALDQRNEFGLLFGMPIGVKDNIVTKNLRTTCASKILENFDPVYDATVVKHLQTAEAVTIG
KLNMDEFAMGSSTENSGFKPTRNPWNLDTVPGGSSGGSAAAVAAGEVLFSLGSDTGGSIR
QPAAYCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRNVEDNAYLLQAITGVDEMDSTS
ANVEVPDFLSSLTGDVKGLKIAVPKEYLGEGVDEAVKQSVLDSLKVLEGLGATWEEVSLP
HSKYALATYYLISSSEASANLARFDGVRYGYRSDNAENLLELYKQSRAEGFGNEVKRRIM
LGTYALSSGYYDAYYKKAQKVRTLIKQDFDNVFEKYDVIIGPTTPTPAFKIGENVKDPLT
MYANDILTIPVNLAGVPGISVPCGLSNGLPLGLQIIGKHFDESTIYRVAHAFEQATEHHK
LKPEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggagctttttgatcgtaaaatatcagaattaaaagaacttttacataaaaaagaaatt
acggtttctgatttagtcgatacgtcttacaaaagaattcaagaggttgacgacaaggtt
ggagcatttttaacattaaatgaagaagacgcacgtacatatgctaaagaattggatgag
gcgttagatcaacgtaacgaatttggcttgctttttggtatgcctattggtgtgaaggac
aatatcgtcacgaaaaatctccgtacgacatgtgcgagtaaaatcctagaaaactttgac
ccagtttatgatgcgacagtggttaagcacctgcaaactgcagaggcagtcacaattggt
aaattaaatatggatgagtttgcgatgggatcttcgactgaaaactctggattcaagcca
acgagaaacccttggaacctagatactgttcctggtggatcaagtggtggttcagcagcg
gcagtagcagctggagaggttcttttctctttaggctctgatacaggtggttcaattcgt
cagcctgcagcctattgtggagtagtcggattaaagcctacatatggccgtgtgtcacgt
ttcggacttgttgcctttgcgtcttctttagaccaaatcggaccaatcactcgaaatgta
gaggacaacgcgtacttacttcaagcaattactggtgtggatgaaatggattccacttct
gcaaacgtggaagtaccagactttttatcttctttaactggcgatgtgaaaggactgaaa
atcgctgttccgaaagaatatttaggtgaaggtgtagatgaggcggttaagcaatctgtt
ctggattcactaaaggtattagaaggactaggagcaacatgggaagaggtttcactccct
cactctaaatatgctcttgctacgtattatttaatttcttcgtctgaagcatcagcgaac
ttggctcgttttgatggtgtacgctatggctaccgttcagacaatgcagaaaatctttta
gagctatacaagcaaagtcgtgcagagggcttcggtaacgaagtaaaacgtcgtattatg
cttggtacgtatgcccttagctctggctattatgatgcgtattacaaaaaagctcaaaag
gttcgtacattaattaagcaggattttgataacgtttttgaaaaatacgatgtaatcatt
ggaccaacaactccaacaccagcatttaaaattggtgaaaacgtgaaggatccattaact
atgtatgcaaatgatattttaaccattccagtaaacttagcgggcgtaccaggaatttct
gttccatgtggcttatcaaacggtctaccactaggcttacaaattatcggaaagcatttc
gatgaaagcaccatttatcgtgttgcgcatgcattcgagcaagcaacagaacatcataaa
ctaaaacctgaactgtaa

DBGET integrated database retrieval system