KEGG   Bacillus weihaiensis: A9C19_18660Help
Entry
A9C19_18660       CDS       T04822                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00473  D-Alanine metabolism
bwh01100  Metabolic pathways
bwh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9C19_18660
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A9C19_18660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bwh01011]
    A9C19_18660
Enzymes [BR:bwh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A9C19_18660
Peptidoglycan biosynthesis and degradation proteins [BR:bwh01011]
 Precursor biosynthesis
  Racemase
   A9C19_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APH06569
UniProt: A0A1L3MW49
LinkDB All DBs
Position
complement(3949105..3950274)
Genome map
AA seq 389 aa AA seqDB search
MQEGFYRDTWVEVNLDAISQNVSAMKKLIGEQTKIIAVVKANAYGHGAIQVAHAALESGA
SMLAVAFLDEAIQLRQAGFDCPILVMGATRAQDVHVAVSYGITLTIFSLDWAKEASQYVD
QGDVLLHVKVDTGMGRLGVTGVDELQAILEFAQEHEHFHIEGIFTHFATADETNSPYYLK
QLAKFQEVIADVPKGNLLIHCANSAAGLKDKASLYNAVRQGISMYGLTPSVEMKKELPFE
LHEAFSLKTKLVHVKQLKKGDKVSYGATYEAEENEWIGTLPIGYADGWLRKLQDSEVLIE
GKRMQLVGRICMDQCMVKLPYELPVGTNVTLIGRQGNEVISSDEVAERLETINYEVPCTI
SSRVPRIFFKKQRIIEKANPLLLKRPGKV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaggtttttaccgagatacttgggtggaagtgaacttagatgcaatctctcaa
aatgtgtcggcaatgaaaaagctgattggagagcaaacaaaaattatagcggttgtcaaa
gcgaatgcgtatggacatggagcgatacaagttgctcatgctgcgttagaatcaggagct
tccatgttagctgtggcttttttggatgaagcgattcaattaaggcaggctggatttgat
tgtccgatccttgtaatgggagcaacccgagctcaagatgtgcatgttgcggtaagctat
ggaattaccttgactatcttttctttagattgggcaaaggaagcaagtcaatatgtcgat
caaggcgatgtgttgttacatgtgaaggttgacacaggtatggggcgcctaggtgttaca
ggagtggatgagctacaggcaattttagagtttgctcaagaacatgagcattttcatata
gagggaatctttactcattttgcaactgcagatgagacaaattctccttattatttaaag
caacttgccaagttccaggaagtaatagcagatgttccaaaggggaatttattgattcat
tgtgcgaatagtgctgcagggttgaaggataaagcaagcttatacaatgcagtgagacaa
gggatttctatgtatggattaaccccttctgttgaaatgaaaaaggaattgccttttgaa
ctccatgaagcattttctttaaaaacaaagcttgtccatgtaaaacaattaaaaaagggc
gataaagtaagctatggtgcaacatatgaagcagaagaaaacgaatggattggtaccctt
ccaataggatatgctgatggctggttgcggaaattgcaggattccgaagtgttaatagag
ggcaagcgaatgcaattagtcggaagaatctgtatggatcagtgtatggtaaaattacca
tatgagctaccggtcggtacaaacgtaacgcttattggtaggcaaggaaatgaagtaatc
tcctccgatgaagtggcagaacgactagaaaccattaattatgaggttccctgcacgatc
tcttcacgagttcctcgcatctttttcaaaaagcagcgtataattgaaaaggcaaatcca
cttcttctaaaaagaccaggaaaagtataa

DBGET integrated database retrieval system