KEGG   Bacillus weihaiensis: A9C19_19260Help
Entry
A9C19_19260       CDS       T04822                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bwh  Bacillus weihaiensis
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bwh03012]
    A9C19_19260
   03029 Mitochondrial biogenesis [BR:bwh03029]
    A9C19_19260
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bwh04147]
    A9C19_19260
Translation factors [BR:bwh03012]
 Eukaryotic Type
  Elongation factors
   A9C19_19260
 Prokaryotic Type
   A9C19_19260
Mitochondrial biogenesis [BR:bwh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A9C19_19260
Exosome [BR:bwh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A9C19_19260
  Exosomal proteins of breast cancer cells
   A9C19_19260
  Exosomal proteins of colorectal cancer cells
   A9C19_19260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DUF5330
Motif
Other DBs
NCBI-ProteinID: APH06667
UniProt: A0A1L3MWF5
LinkDB All DBs
Position
complement(4049026..4050216)
Genome map
AA seq 396 aa AA seqDB search
MGKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLAKRSGKGAAMAYDMIDAAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREH
ILLSRQVGVPYLVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIKGSALKAL
EGEADWEEKIVELMNAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDVIDIIGITEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVARDDIQRGQVLAKPGT
ITPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGICQLPEGVEMVMPGDNVE
MSVELIAPIAIEEGTKFSIREGGRTVGAGVVATIQE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagaaaaattcgaccgttccaaaacgcatgctaatatcggtacaatcggacac
gttgaccacggtaaaactacattaacagctgcaatcactactgtacttgctaagcgcagt
ggtaaaggtgctgctatggcatatgacatgatcgatgctgctcctgaagagcgtgagcgt
ggaatcacaatctcaactgcacacgttgagtatgaaactgacactcgtcactacgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcacaaatg
gacggtggtatcttagtagtatctgctgctgatggtccaatgccacaaactcgtgagcac
atcctattatctcgtcaagtaggtgtaccttaccttgttgtattcttaaacaaatgtgac
atggtagatgacgaagaattattagaactagttgaaatggaagtacgtgacttactatct
gagtacgatttccctggtgacgatgttcctgtaatcaaaggttcagctcttaaagctctt
gaaggagaagctgattgggaagagaaaatcgttgagctaatgaacgctgttgacgaatac
atcccaactcctgagcgtgacactgagaagccattcatgatgccagtagaggacgtattc
tctatcactggtcgtggaactgttgctacaggtcgtgttgagcgtggacaagttaaagtt
ggagacgtaatcgatattatcggtattacggaagagccaaaatcaactactgtaacaggt
gttgaaatgttccgtaagcttcttgattacgctgaagctggagacaacatcggtgcactt
cttcgtggagtagctcgtgacgatatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacacaaagttcaaagctgaagtttacgttttatcaaaagaagaaggtgga
cgtcacactccattcttcactaactaccgcccacagttctacttccgtacaactgatgta
actggtatctgccaattaccagaaggcgtagaaatggttatgcctggagataacgttgaa
atgtcagttgagcttatcgctccaatcgcaatcgaagaaggaactaagttctcaattcgt
gaaggtggacgtacagtaggcgctggcgttgtagctacaatccaagaataa

DBGET integrated database retrieval system