KEGG   Bacillus weihaiensis: A9C19_19545Help
Entry
A9C19_19545       CDS       T04822                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
bwh  Bacillus weihaiensis
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bwh03110]
    A9C19_19545
Chaperones and folding catalysts [BR:bwh03110]
 Heat shock proteins
  HSP33
   A9C19_19545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF3143 DpnD-PcfM
Motif
Other DBs
NCBI-ProteinID: APH07182
UniProt: A0A1L3MXX2
LinkDB All DBs
Position
complement(4106636..4107514)
Genome map
AA seq 292 aa AA seqDB search
MMDYLVKALAFDNKVRAYAAKTTDTVGEAQKRHQTWPTASAALGRSMTAGVILGSMLKGD
AKLTVKVEGGGPIGAILVDSNAKGEVRGYVTNPQTHFDLNDKGKLDVARAVGTDGNLTIV
KDIGMKDHFSGQVPIVSGELGEDFTYYLVTSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
LPGTDDETIATIEERLNTIEPISKLIQRGLSPEEILNEVLGEGNVRILEKQPVAFKCQCS
KERIENAIISLGKGEIQAMIEEEGQAEAQCHFCNEQYVLSREDLENLLQEAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atcatggattatttagtaaaagcattggcctttgataacaaggtccgtgcgtatgcagca
aaaacaacagatacggtcggggaagctcagaaaaggcatcaaacatggccaacagcttct
gcagcgttaggtcgctcaatgacagcaggcgttatattagggtcgatgttaaagggagat
gcgaagctaactgttaaagttgagggtggtggtccaatcggggctattcttgttgacagt
aatgctaaaggggaagtgagaggctatgtgacgaatcctcaaactcattttgacttaaat
gataaagggaaattagatgttgctagagcagtaggtactgatggtaacctaacaattgtg
aaggatatagggatgaaagaccatttttccggacaggttccaattgtgtctggtgaatta
ggagaagattttacttattatttagtaacatcagaacaggtgccatcatcggtgggtgta
ggtgtacttgttaatccggataacacgatattggcagcaggtggctttatcattcaatta
ctgcctggaacagatgatgaaacaattgctacaattgaagaacgtttaaatacgatagaa
cctatttcaaagctcattcaaagagggttatctcctgaagaaattctaaacgaggtttta
ggagaagggaatgtaagaatccttgagaaacaacctgtagcctttaagtgtcaatgttca
aaggaacgtattgaaaatgcaattattagcttaggcaaaggggaaatccaagcgatgatt
gaagaggaaggacaagctgaagctcaatgtcatttctgtaatgaacaatacgttctttca
agagaagacttagagaatttacttcaagaagctaaataa

DBGET integrated database retrieval system