KEGG   Bacillus weihaiensis: A9C19_20405Help
Entry
A9C19_20405       CDS       T04822                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bwh  Bacillus weihaiensis
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A9C19_20405
Enzymes [BR:bwh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A9C19_20405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like DAO AlaDh_PNT_C Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: APH06842
UniProt: A0A1L3MWY9
LinkDB All DBs
Position
complement(4283685..4285214)
Genome map
AA seq 509 aa AA seqDB search
MILEADIKAQLDQYLQLMEGDIVLKVSAGSDDVSKDMLALVEELASMSPRISSEHANLER
TPSFSVNRIGEDTGITFAGIPLGHEFTSLVLALLQVSGRAPKVDQSIIDQIKNIKGEFHF
ESYISLSCHNCPDVVQALNIMSNLNANITHTMIDGATFKDEVESKNVMAVPTVFLNGESF
GSGRMTLEEILAKMGTGPDASELSDKEPFDVLVVGGGPAGSSAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVRRTEGPKLVASLEEHVKEYGIDVMNLQKAKRLEKKDLFELELE
SGAILKSKTVIVSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGV
EAAIDLAGIVNHVTVLEFMPELKADAVLQERLHSLPNVTVLTNVQTKEITGTDTVNGITY
ISRETGAEKHVPLHGVFVQIGLVPNTDWLDETVERNRIGEIVVDKHGATTVPGLFAAGDC
TDGPYNQIIISMGSGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgaagcagatattaaagcacagctagaccaataccttcaattgatggaaggt
gatatcgtattaaaggtcagcgcaggctctgatgatgtttcaaaagacatgctagctctt
gttgaagagctagcttcaatgtctccgagaatctcatctgaacatgcaaaccttgaaaga
acaccaagctttagtgtaaaccgcattggcgaagatacaggtattacattcgctggaatt
ccacttggacatgagttcacctctttagtattagcccttctacaagttagcggaagagca
ccaaaggttgatcaaagtattattgatcaaatcaaaaacataaaaggcgaatttcatttt
gaatcatacattagcttaagctgtcacaattgccctgatgttgtacaggctctaaacatt
atgagtaacttaaatgctaatatcactcatacaatgatcgatggagcaacctttaaggat
gaagttgaaagcaagaacgtgatggctgttccaactgtcttcttaaacggagaatcattt
ggtagtggtcgtatgacgcttgaagaaattcttgcaaaaatgggaactggcccagatgca
tcagagctttctgataaagaaccttttgacgtgttagttgtgggtggcggccctgcaggt
tcaagtgcagcaatttatgcagcacgtaaaggaatccgtacaggaattgttgctgagcgt
tttggcggacaggtacttgatacaatgagtattgagaactttataagcgtaaggcgtaca
gaaggtccaaagcttgttgccagccttgaagagcatgtaaaagagtatggtatcgatgtc
atgaaccttcaaaaagcaaaacgtcttgagaaaaaagatctttttgagcttgagcttgaa
agtggagctatcttaaaaagtaaaacggtcatcgtttcaacaggtgctcgctggcgtaac
gtaaatgtaccaggtgagcaagaattcaaaaacaaaggtgttgcttactgcccacactgt
gacggtcctctatttgaaggaaaagacgttgcagtaattggcggagggaactctggtgtc
gaagcagctattgatttagctggtatcgtaaaccacgtaacagttcttgaattcatgcct
gaattaaaagcagatgctgttctacaggaacgtttacacagtttaccaaatgtaaccgtg
ctaacaaatgttcaaacaaaagaaattacgggtacagatactgtaaatggtattacatac
atcagtcgtgagacaggtgctgaaaaacatgtaccattacacggtgtatttgttcagatc
ggtcttgttcctaatacagactggttagatgaaacagttgaacgtaaccgtattggtgag
atcgtcgttgataaacatggtgcaacaacggttccagggttatttgcagccggtgactgt
actgacggtccatacaaccaaattattatttcaatgggttcaggtgcaactgcttcatta
ggtgcatttgattacttaatacgaaactaa

DBGET integrated database retrieval system