KEGG   Bacillus mycoides WSBC 10204: bwei_0702Help
Entry
bwei_0702         CDS       T03453                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase, AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bww01100  Metabolic pathways
bww01110  Biosynthesis of secondary metabolites
bww01130  Biosynthesis of antibiotics
bww01230  Biosynthesis of amino acids
Module
bww_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bwei_0702 (aroK)
Enzymes [BR:bww01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     bwei_0702 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_17 Cytidylate_kin2 AAA_33 dNK Thymidylate_kin AAA
Motif
Other DBs
NCBI-ProteinID: AIW83368
UniProt: C2Q0T2
LinkDB All DBs
Position
633443..633913
Genome map
AA seq 156 aa AA seqDB search
MGAGKTTIGKVLSKELHMDVVDTDQKIEEKQEKAIRDIFAEEGEMAFREYESEMLRSLPV
QNVIITTGGGIIERAENRKWMKENGTVVYLYCDPHVIAERLREDTTRPLFQKKDIDAFIT
KFESRRAYYEEADIHIDTTNKSVKQIMNELKQKINE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgggaaaacaacaattggaaaagtgttaagtaaagaacttcatatggatgtt
gtagatacagaccaaaaaattgaagagaagcaagagaaggcaattcgtgatatttttgcc
gaagaaggcgaaatggcttttcgggaatatgaaagtgaaatgttacgttcactaccggtt
cagaatgtaattattacaacgggtggagggattattgaacgagcggaaaatcgaaagtgg
atgaaggaaaatggaactgttgtgtatttatattgcgatccacatgtaattgcagaaagg
cttcgtgaagatacgacacgtccactatttcagaagaaagatatagatgcatttataacg
aaatttgaatcgcgccgagcttattatgaagaggctgatattcatatcgatacgacaaat
aagtcggtaaagcaaattatgaatgaattaaagcaaaagattaatgaataa

DBGET integrated database retrieval system