KEGG   Bacillus mycoides WSBC 10204: bwei_2947Help
Entry
bwei_2947         CDS       T03453                                 

Gene name
alr2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00473  D-Alanine metabolism
bww01100  Metabolic pathways
bww01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bwei_2947 (alr2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    bwei_2947 (alr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bww01011]
    bwei_2947 (alr2)
Enzymes [BR:bww01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     bwei_2947 (alr2)
Peptidoglycan biosynthesis and degradation proteins [BR:bww01011]
 Precursor biosynthesis
  Racemase
   bwei_2947 (alr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker
Motif
Other DBs
NCBI-ProteinID: AIW85566
UniProt: A0A0A0WM97
LinkDB All DBs
Position
complement(2771897..2773072)
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKSAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLQGIDEVA
NHLQKKVRIHVKIDTGMSRIGLQEEEVKPFFEELKRMRYVEVVGMFTHYSTADEIDKTYT
NMQTSLFEKAVNTAEELGIHFPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSREVDH
TVASLQPALSLKSKVAHVKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVTNAMPVQVGDEVVFYGKQDEEEIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENDETTAIVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgaaatatggaagagatacaattgttgaagttgacttaaatgcggtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcgaaatcggctattgaagcagga
ataaaccaacttgcagttgcatttgtagatgaagcaattgaattaagagaagctggaatc
actgtacctattttaattttaggatatacaccagtagcagctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacaaggtatagatgaagttgca
aaccatcttcaaaagaaagtgcgaattcatgtgaaaattgatacaggaatgagccgtatt
ggtttacaggaagaagaagttaaaccgttttttgaagagttaaaacgtatgcgatatgta
gaagtagtagggatgtttacacattactctaccgctgatgaaatagataaaacttataca
aatatgcaaacaagtttgtttgagaaagctgtaaatacagcggaagaattaggaattcat
tttccatatattcatagttcaaacagtgcaggatcaatggaacttagtaacacatttcaa
aatatggttcgtgtcggtattggaatttacggtatgtatccttcaagagaagtggatcat
acagttgcttccttacagccagcgttgtctttaaaatcaaaagtagctcatgttaaacat
gcgaagaaaaatcgtggtgttagctatgggaatacttatgtaacaacgggcgaagaatgg
attgcaactgtaccgattggttatgctgatggttataatcgtcagctatctaataaaggg
catgcactaataaacggagtacgagtacctgtaattggccgtgtttgtatggatcagctt
atgctagatgttacaaatgcaatgccagtacaagtaggagacgaagttgtattctacggc
aaacaagatgaagaagagattgcggtagaagaaatagcagatatgctaggtacaattaac
tatgaagttacatgtatgttggacagaagaattccacgtgtctataaagaaaatgatgaa
acgactgcaattgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system