KEGG   Paraburkholderia xenovorans LB400: DR64_1224Help
Entry
DR64_1224         CDS       T03290                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
bxb  Paraburkholderia xenovorans LB400
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF3819
Motif
Other DBs
NCBI-ProteinID: AIP33771
UniProt: Q143M8
LinkDB All DBs
Position
1:complement(1307976..1309511)
Genome map
AA seq 511 aa AA seqDB search
MLAEQPGNPSTAPAPLKHPDKLYIDGQWVAASTGKEFSVISPDTESVYVRVGEASEADIE
KAVSAARKAFDHGPWPRLSHAERGAYLRAMAEKLRARSHDMAAIWPHEMGVTYAFAQSFM
PRIAGIYDFYANLGDTFAFEERHATSSGIGNGLLVREPVGVVGAIIPWNAPAMIIAYKLA
PALIAGCTVILKSSPEAPGMALIIAEVAEEVGLPPGVVNVVTADRQASDALVRNAAVDKI
SFTGSSAVGKHIGSVLAQRVGRYTLELGGKSAAIVLDDYDLETAAKALATAASQMTCQVC
ASLTRIIVTKNRHDRLLEALASAYSSVKVGSPFDPATQMGPVATLRQRERVETYIAKGMQ
AGFTLAAGGKRPVHLPRGFYLEPTVFGNVSNRSELAQEEIFGPVLAVIPADSEEQAVEIA
NDSIYGLSGAVFTNDVDRAYSVARRVRTGSVAHNGFRNDFGIAFGGFKQSGIGREGGVEG
LMPYLETKTVLLEKLPSHHQTTQPRIVDSPA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgaacagccgggaaatccgtcgacagcgccggctccgctgaagcatcccgac
aaactgtatatcgacgggcagtgggtcgcagcctccaccggaaaggagttttcggtcatc
tcgccggatacggaaagcgtctatgtccgggtcggcgaggcaagcgaggccgatattgaa
aaggcagtttcggctgcccgcaaagcgttcgatcacgggccgtggcctcggctgagccat
gcggagcgaggcgcttatcttcgcgcgatggcggaaaaactgcgggcgcgctcgcacgac
atggccgcgatctggccgcacgagatgggcgtcacttacgcgttcgcgcagtcgttcatg
ccgcgcatcgcgggcatctacgacttctacgccaatctcggcgacacgttcgctttcgaa
gaacggcacgccaccagctcgggaatcggcaacgggctgctcgttcgcgagcccgtaggc
gtggtcggcgcgatcattccatggaatgcgcccgcgatgatcatcgcgtacaagctggcg
cccgcgttgatcgccggttgtaccgtgatcctcaagtcttcgccggaagcgccgggcatg
gcgctgataatcgcagaggtcgcggaggaagtcggtctgccgcccggagtcgtcaacgtg
gtcactgccgatcggcaagcgtcggacgcgctggtgcgaaacgctgcggtcgacaaaata
agctttaccggttcgagcgcggtcggcaagcatatcggcagcgtgcttgcgcagcgggtg
gggcgatataccctcgaactgggcggcaagtcggccgctatcgtactcgacgactacgac
ctggagacggcggcaaaagcgcttgcgacggcagcaagccagatgacctgccaggtttgt
gcgagcctgacccgcatcatcgtcaccaaaaaccgccacgaccgcctgctcgaagcgctc
gcctctgcgtattcctcggtgaaggttggcagtccgttcgatcccgccacgcaaatggga
cctgtggccacgctcaggcagagagagcgtgtcgagacctatatcgcgaaaggcatgcag
gccggtttcacgttagccgccggcggcaagcgtccggttcacctgccgcgtgggttctat
ctggagccgacggtgttcggcaacgtcagtaaccgttccgaactcgctcaggaggagata
ttcggtccggtgctcgccgtgattcccgccgacagcgaagagcaggcagtcgagatcgcg
aacgattccatctatgggttgagcggcgcggtgttcaccaacgacgttgatcgagcctat
tcggtcgcccgcagggtccgcaccggcagcgtggcccataacgggttccgcaacgacttc
ggcatcgctttcggcggcttcaaacagtccggcatcggtcgtgagggcggtgtcgaaggc
ttgatgccctatctcgagaccaagaccgtgctgctggaaaaactgccgtcgcatcatcaa
acaacgcaacctagaatagtggattcgccagcatga

DBGET integrated database retrieval system